SURP and G-patch domain-containing protein 1 (SUGP1) Recombinant Protein | SUGP1 recombinant protein
Recombinant Human SURP and G-patch domain-containing protein 1 (SUGP1)
Gene Names
SUGP1; RBP; SF4; F23858
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SURP and G-patch domain-containing protein 1 (SUGP1); Recombinant Human SURP and G-patch domain-containing protein 1 (SUGP1); SUGP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-645, Full length protein
Sequence
MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPTPSAGKRSLLISRRTGLGLASLPGPVKSYSHAKQLPVAHRPSVFQSPDEDEEEDYEQWLEIKVSPPEGAETRKVIEKLARFVAEGGPELEKVAMEDYKDNPAFAFLHDKNSREFLYYRKKVAEIRKEAQKSQAASQKVSPPEDEEVKNLAEKLARFIADGGPEVETIALQNNRENQAFSFLYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY
Sequence Length
645
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,297 Da
NCBI Official Full Name
SURP and G-patch domain-containing protein 1
NCBI Official Synonym Full Names
SURP and G-patch domain containing 1
NCBI Official Symbol
SUGP1
NCBI Official Synonym Symbols
RBP; SF4; F23858
NCBI Protein Information
SURP and G-patch domain-containing protein 1
UniProt Protein Name
SURP and G-patch domain-containing protein 1
Protein Family
UniProt Gene Name
SUGP1
UniProt Synonym Gene Names
SF4
NCBI Description
SF4 is a member of the SURP family of splicing factors.[supplied by OMIM, Sep 2003]
Uniprot Description
Plays a role in pre-mRNA splicing.
Research Articles on SUGP1
Similar Products
Product Notes
The SUGP1 sugp1 (Catalog #AAA1467881) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-645, Full length protein. The amino acid sequence is listed below: MSLKMDNRDV AGKANRWFGV APPKSGKMNM NILHQEELIA QKKREIEAKM EQKAKQNQVA SPQPPHPGEI TNAHNSSCIS NKFANDGSFL QQFLKLQKAQ TSTDAPTSAP SAPPSTPTPS AGKRSLLISR RTGLGLASLP GPVKSYSHAK QLPVAHRPSV FQSPDEDEEE DYEQWLEIKV SPPEGAETRK VIEKLARFVA EGGPELEKVA MEDYKDNPAF AFLHDKNSRE FLYYRKKVAE IRKEAQKSQA ASQKVSPPED EEVKNLAEKL ARFIADGGPE VETIALQNNR ENQAFSFLYE PNSQGYKYYR QKLEEFRKAK ASSTGSFTAP DPGLKRKSPP EALSGSLPPA TTCPASSTPA PTIIPAPAAP GKPASAATVK RKRKSRWGPE EDKVELPPAE LVQRDVDASP SPLSVQDLKG LGYEKGKPVG LVGVTELSDA QKKQLKEQQE MQQMYDMIMQ HKRAMQDMQL LWEKAVQQHQ HGYDSDEEVD SELGTWEHQL RRMEMDKTRE WAEQLTKMGR GKHFIGDFLP PDELEKFMET FKALKEGREP DYSEYKEFKL TVENIGYQML MKMGWKEGEG LGSEGQGIKN PVNKGTTTVD GAGFGIDRPA ELSKEDDEYE AFRKRMMLAY RFRPNPLNNP RRPYY. It is sometimes possible for the material contained within the vial of "SURP and G-patch domain-containing protein 1 (SUGP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
