STIP1 homology and U box-containing protein 1 (Stub1) Recombinant Protein | Stub1 recombinant protein

Recombinant Mouse STIP1 homology and U box-containing protein 1 (Stub1)

Cat. Num. AAA1378888

• Gene Names: Stub1; Chip; AW046544; 0610033N24Rik; 2210017D18Rik; 2310040B03Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: STIP1 homology and U box-containing protein 1 (Stub1); Recombinant Mouse STIP1 homology and U box-containing protein 1 (Stub1); Stub1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-304, full length protein
• Sequence: MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
• Sequence Length: 304

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 9789907
• NCBI GeneID: 56424
• NCBI Accession #: NP_062693.1
• NCBI GenBank Nucleotide #: NM_019719.3
• UniProt Accession #: Q9WUD1; Q9DCJ0
• Molecular Weight: 34,909 Da
• NCBI Official Full Name: STIP1 homology and U box-containing protein 1
• NCBI Official Synonym Full Names: STIP1 homology and U-Box containing protein 1
• NCBI Official Symbol: Stub1
• NCBI Official Synonym Symbols: Chip; AW046544; 0610033N24Rik; 2210017D18Rik; 2310040B03Rik
• NCBI Protein Information: STIP1 homology and U box-containing protein 1
• UniProt Protein Name: STIP1 homology and U box-containing protein 1
• Protein Family: STIP1 homology and U box-containing protein
• UniProt Gene Name: Stub1

Uniprot Description

E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. Collaborates with ATXN3 in the degradation of misfolded chaperone substrates: ATXN3 restricting the length of ubiquitin chain attached to STUB1/CHIP substrates and preventing further chain extension. Ubiquitinates NOS1 in concert with Hsp70 and Hsp40. Modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. Mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. Mediates polyubiquitination of DNA polymerase beta (POLB) at 'Lys-41', 'Lys-61' and 'Lys-81', thereby playing a role in base-excision repair: catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome. Mediates polyubiquitination of CYP3A4. Ubiquitinates EPHA2 and may regulate the receptor stability and activity through proteasomal degradation. Negatively regulates the suppressive function of regulatory T-cells (Treg) during inflammation by mediating the ubiquitination and degradation of FOXP3 in a HSPA1A/B-dependent manner (PubMed:23973223). Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and promotes ubiquitin-mediated protein degradation. Negatively regulates TGF-beta signaling by modulating the basal level of SMAD3 via ubiquitin-mediated degradation ().