SDS-PAGE
StAR-related lipid transfer protein 7 Recombinant Protein | STARD7 recombinant protein
Recombinant Human StAR-related lipid transfer protein 7, mitochondrial
Gene Names
STARD7; GTT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
StAR-related lipid transfer protein 7; Recombinant Human StAR-related lipid transfer protein 7; mitochondrial; Gestational trophoblastic tumor protein 1; START domain-containing protein 7; StARD7; STARD7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
61-307. Partial
Sequence
LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV
Sequence Length
307
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Product Categories/Family for STARD7 recombinant protein
References
GTT1/StarD7, a novel phosphatidylcholine transfer protein-like highly expressed in gestational trophoblastic tumour
cloning and characterization.Durand S., Angeletti S., Genti-Raimondi S.Placenta 25:37-44(2004)
Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56.5 kDa
NCBI Official Full Name
stAR-related lipid transfer protein 7, mitochondrial
NCBI Official Synonym Full Names
StAR related lipid transfer domain containing 7
NCBI Official Symbol
STARD7
NCBI Official Synonym Symbols
GTT1
NCBI Protein Information
stAR-related lipid transfer protein 7, mitochondrial
UniProt Protein Name
StAR-related lipid transfer protein 7, mitochondrial
Protein Family
UniProt Gene Name
STARD7
UniProt Synonym Gene Names
GTT1; StARD7
UniProt Entry Name
STAR7_HUMAN
Uniprot Description
STARD7:
Chromosomal Location of Human Ortholog: 2q11.2
Cellular Component: mitochondrion
Molecular Function: lipid binding
Research Articles on STARD7
Similar Products
Product Notes
The STARD7 stard7 (Catalog #AAA717369) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 61-307. Partial. The amino acid sequence is listed below: LWRRLHGRPG HASALMAALA GVFVWDEERI QEEELQRSIN EMKRLEEMSN MFQSSGVQHH PPEPKAQTEG NEDSEGKEQR WEMVMDKKHF KLWRRPITGT HLYQYRVFGT YTDVTPRQFF NVQLDTEYRK KWDALVIKLE VIERDVVSGS EVLHWVTHFP YPMYSRDYVY VRRYSVDQEN NMMVLVSRAV EHPSVPESPE FVRVRSYESQ MVIRPHKSFD ENGFDYLLTY SDNPQTVFPR YCVSWMV . It is sometimes possible for the material contained within the vial of "StAR-related lipid transfer protein 7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
