Rabbit anti-Human AQP1 Polyclonal Antibody | anti-AQP1 antibody

AQP1 Antibody - C-terminal region

Cat. Num. AAA3220749

• Gene Names: AQP1; CO; CHIP28; AQP-CHIP
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: AQP1; Polyclonal Antibody; AQP1 Antibody - C-terminal region; anti-AQP1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
• Sequence: Synthetic peptide located within the following region: PFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVE
• Sequence Length: 269

• Applicable Applications for anti-AQP1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AQP1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AQP1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RatTarget Name: AQP1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

Related Product Information for anti-AQP1 antibody

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). This gene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayer spanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant in erythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involving imbalance in ocular fluid movement. Several transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-AQP1 antibody

Polyclonal

NCBI and Uniprot Product Information

• NCBI GI #: 297307116
• NCBI GeneID: 358
• NCBI Accession #: NP_001171989.1
• NCBI GenBank Nucleotide #: NM_001185060.1
• UniProt Accession #: B4F4P6; P29972
• Molecular Weight: 29 kDa
• NCBI Official Synonym Full Names: aquaporin 1 (Colton blood group)
• NCBI Official Symbol: AQP1
• NCBI Official Synonym Symbols: CO; CHIP28; AQP-CHIP
• NCBI Protein Information: aquaporin-1

NCBI Description

This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016]