Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Beta-galactoside alpha-2,6-sialyltransferase 1 Recombinant Protein | ST6GAL1 recombinant protein

Beta-galactoside alpha-2,6-sialyltransferase 1

Gene Names
ST6GAL1; ST6N; SIAT1; ST6GalI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-galactoside alpha-2; 6-sialyltransferase 1; ST6GAL1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-406. Full Length
Sequence
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

SDS-PAGE
Related Product Information for ST6GAL1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ST6GAL1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52.1 kDa
NCBI Official Full Name
beta-galactoside alpha-2,6-sialyltransferase 1 isoform a
NCBI Official Synonym Full Names
ST6 beta-galactoside alpha-2,6-sialyltransferase 1
NCBI Official Symbol
ST6GAL1
NCBI Official Synonym Symbols
ST6N; SIAT1; ST6GalI
NCBI Protein Information
beta-galactoside alpha-2,6-sialyltransferase 1
UniProt Protein Name
Beta-galactoside alpha-2,6-sialyltransferase 1
UniProt Gene Name
ST6GAL1
UniProt Synonym Gene Names
SIAT1; Alpha 2,6-ST 1; ST6GalI
UniProt Entry Name
SIAT1_HUMAN

NCBI Description

This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Three transcript variants encoding two different isoforms have been described. [provided by RefSeq, Aug 2009]

Uniprot Description

SIAT1: a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. Is normally found in the trans cisternae of the Golgi but which can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CDw75, and CD76. This protein is a member of glycosyltransferase family 29. Three transcript variants encoding two different isoforms have been found.

Protein type: Glycan Metabolism - N-glycan biosynthesis; Membrane protein, integral; EC 2.4.99.1; Transferase

Chromosomal Location of Human Ortholog: 3q27.3

Cellular Component: Golgi membrane

Molecular Function: beta-galactoside alpha-2,6-sialyltransferase activity; protein binding; sialyltransferase activity

Biological Process: humoral immune response; N-acetylneuraminate metabolic process; O-glycan processing; oligosaccharide metabolic process; protein amino acid N-linked glycosylation via asparagine

Research Articles on ST6GAL1

Similar Products

Product Notes

The ST6GAL1 st6gal1 (Catalog #AAA7043370) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-406. Full Length. The amino acid sequence is listed below: MIHTNLKKKF SCCVLVFLLF AVICVWKEKK KGSYYDSFKL QTKEFQVLKS LGKLAMGSDS QSVSSSSTQD PHRGRQTLGS LRGLAKAKPE ASFQVWNKDS SSKNLIPRLQ KIWKNYLSMN KYKVSYKGPG PGIKFSAEAL RCHLRDHVNV SMVEVTDFPF NTSEWEGYLP KESIRTKAGP WGRCAVVSSA GSLKSSQLGR EIDDHDAVLR FNGAPTANFQ QDVGTKTTIR LMNSQLVTTE KRFLKDSLYN EGILIVWDPS VYHSDIPKWY QNPDYNFFNN YKTYRKLHPN QPFYILKPQM PWELWDILQE ISPEEIQPNP PSSGMLGIII MMTLCDQVDI YEFLPSKRKT DVCYYYQKFF DSACTMGAYH PLLYEKNLVK HLNQGTDEDI YLLGKATLPG FRTIHC . It is sometimes possible for the material contained within the vial of "Beta-galactoside alpha-2,6-sialyltransferase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.