Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Serine/threonine-protein kinase ssn3 (ssn3) Recombinant Protein | ssn3 recombinant protein

Recombinant Aspergillus clavatus Serine/threonine-protein kinase ssn3 (ssn3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase ssn3 (ssn3); Recombinant Aspergillus clavatus Serine/threonine-protein kinase ssn3 (ssn3); ssn3 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-426, Full length protein
Sequence
MFGRNFPFFNSIGGFYPRDSLDPRKPSGTGYTSKVRVRDKYHIVGFISSGTYGRVYKAIGKDGRKGEFAIKKFKPDKEGEIIQYTGLSQSAIREMSLCSELDHSNVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMIKSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAVRIGDLGLARLFYKPLNSLYSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEIMGLPRKETWPGLVAMPEFSQLQSLAMARGHLNRQSNLEGWYQSCLKNNGYSPTSSAGTPGPEGFDLLSRLLEYDPLKRISAQEALEHPYFTTGTPITANCFAGYEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRAAKRLKE
Sequence Length
426
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,035 Da
NCBI Official Full Name
cyclin-dependent protein kinase, putative
NCBI Official Symbol
ACLA_041380
NCBI Protein Information
cyclin-dependent protein kinase, putative
UniProt Protein Name
Serine/threonine-protein kinase ssn3
UniProt Gene Name
ssn3
UniProt Synonym Gene Names
cdk8

Uniprot Description

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II ().

Similar Products

Product Notes

The ssn3 ssn3 (Catalog #AAA1078443) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-426, Full length protein. The amino acid sequence is listed below: MFGRNFPFFN SIGGFYPRDS LDPRKPSGTG YTSKVRVRDK YHIVGFISSG TYGRVYKAIG KDGRKGEFAI KKFKPDKEGE IIQYTGLSQS AIREMSLCSE LDHSNVVQLA EIILEDKCIF MVFEYTEHDL LQIIHHHTQP QRHAIPAPMI KSILFQLLNG LLYLHTNWVL HRDLKPANIL VTSSGAVRIG DLGLARLFYK PLNSLYSGDK VVVTIWYRAP ELLMGSRHYT PAVDLWAVGC IFAELLSLRP IFKGEEAKMD SKKTVPFQRN QMMKIVEIMG LPRKETWPGL VAMPEFSQLQ SLAMARGHLN RQSNLEGWYQ SCLKNNGYSP TSSAGTPGPE GFDLLSRLLE YDPLKRISAQ EALEHPYFTT GTPITANCFA GYEGKYPHRR VTQDDNDIRS GSLPGTKRSG LPDDSLMGRA AKRLKE. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase ssn3 (ssn3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual