Serine/arginine-rich splicing factor 1 (Srsf1) Recombinant Protein | Srsf1 recombinant protein

Recombinant Mouse Serine/arginine-rich splicing factor 1 (Srsf1)

Cat. Num. AAA1455506

• Gene Names: Srsf1; Asf; Sf2; Sfrs1; AI482334; AW491331; 1110054N12Rik; 5730507C05Rik; 6330415C05Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Serine/arginine-rich splicing factor 1 (Srsf1); Recombinant Mouse Serine/arginine-rich splicing factor 1 (Srsf1); Srsf1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-248, full length protein
• Sequence: SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
• Sequence Length: 247

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 118582271
• NCBI GeneID: 110809
• NCBI Accession #: NP_001071635.1
• NCBI GenBank Nucleotide #: NM_001078167.2
• UniProt Accession #: Q6PDM2; Q3UCH2; Q5SXC5; Q8BJV3; Q8C1H9; B2KGJ5
• Molecular Weight: 21,807 Da
• NCBI Official Full Name: serine/arginine-rich splicing factor 1 isoform 2
• NCBI Official Synonym Full Names: serine/arginine-rich splicing factor 1
• NCBI Official Symbol: Srsf1
• NCBI Official Synonym Symbols: Asf; Sf2; Sfrs1; AI482334; AW491331; 1110054N12Rik; 5730507C05Rik; 6330415C05Rik
• NCBI Protein Information: serine/arginine-rich splicing factor 1
• UniProt Protein Name: Serine/arginine-rich splicing factor 1
• Protein Family: Serine/arginine-rich splicing factor
• UniProt Gene Name: Srsf1
• UniProt Synonym Gene Names: Sfrs1

NCBI Description

The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]

Uniprot Description

Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences, either the octamer, 5'-RGAAGAAC-3' (r=A or G) or the decamers, AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro, the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing (). Specifically regulates alternative splicing of cardiac isoforms of CAMK2D, LDB3/CYPHER and TNNT2/CTNT during heart remodeling at the juvenile to adult transition. The inappropriate accumulation of a neonatal and neuronal isoform of CAMKD2 in the adult heart results in aberrant calcium handling and defective excitation-contraction coupling in cardiomyocytes. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway.