Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sterol regulatory element-binding protein 2 (Srebf2) Recombinant Protein | Srebf2 recombinant protein

Recombinant Mouse Sterol regulatory element-binding protein 2 (Srebf2)

Gene Names
Srebf2; nuc; lop13; SREBP2; bHLHd2; SREBP-2; AI608257; SREBP2gc
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sterol regulatory element-binding protein 2 (Srebf2); Recombinant Mouse Sterol regulatory element-binding protein 2 (Srebf2); Srebf2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-473aa; full length protein
Sequence
MDESSELGVLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSN GGSGNNSSGRGNNGGATDPAVQRSFSQVPLSTFSPSAASPQAPALQVKVSPTPPRATPVL QPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTS PQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTD SLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGTILTTMPVMMGQEKV PIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLR KAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIDDFNQNVLLM SPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Srebf2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
119,913 Da
NCBI Official Full Name
sterol regulatory element-binding protein 2
NCBI Official Synonym Full Names
sterol regulatory element binding factor 2
NCBI Official Symbol
Srebf2
NCBI Official Synonym Symbols
nuc; lop13; SREBP2; bHLHd2; SREBP-2; AI608257; SREBP2gc
NCBI Protein Information
sterol regulatory element-binding protein 2
UniProt Protein Name
Sterol regulatory element-binding protein 2
UniProt Gene Name
Srebf2
UniProt Synonym Gene Names
SREBP-2
UniProt Entry Name
SRBP2_MOUSE

Uniprot Description

SREBP-2: Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the cholesterol and to a lesser degree the fatty acid synthesis pathway. Binds the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3') found in the flanking region of the LDRL and HMG-CoA synthase genes. Belongs to the SREBP family.

Protein type: Transcription factor; Membrane protein, integral; DNA-binding; Membrane protein, multi-pass

Cellular Component: cytoplasm; cytoplasmic vesicle; dendrite; endoplasmic reticulum; Golgi apparatus; integral to membrane; intracellular membrane-bound organelle; membrane; nucleus

Molecular Function: chromatin binding; DNA binding; protein binding; protein C-terminus binding; protein dimerization activity; sequence-specific DNA binding; transcription factor activity

Biological Process: cellular response to starvation; cholesterol metabolic process; lipid metabolic process; negative regulation of transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of transcription, DNA-dependent; response to hormone stimulus; steroid metabolic process; transcription, DNA-dependent

Research Articles on Srebf2

Similar Products

Product Notes

The Srebf2 srebf2 (Catalog #AAA7030457) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-473aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Srebf2 srebf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDESSELGVL ETMETLTELG DELTLGDIDE MLQFVSNQVG EFPDLFSEQL CSSFPGGGSN GGSGNNSSGR GNNGGATDPA VQRSFSQVPL STFSPSAASP QAPALQVKVS PTPPRATPVL QPRPQPQPQP PAQLQQQTVM ITPTFSTAPQ TRIIQQPLIY QNAATSFQVL QPQVQSLVTS PQVQPVTIQQ QVQTVQAQRV LTQTANGTLQ TLAPATVQTV AAPQVQQVPV LVQPQIIKTD SLVLTTLKTD GSPVMAAVQN PALTALTAPI QTAALQVPTL VGSNGTILTT MPVMMGQEKV PIKQVPGGVK QLDPPKEGER RTTHNIIEKR YRSSINDKII ELKDLVMGTD AKMHKSGVLR KAIDYIKYLQ QVNHKLRQEN MVLKLANQKN KLLKGIDLGS LVDSDVDLKI DDFNQNVLLM SPPASDSGSQ AGFSPYSIDS EPGSPLLDDA KVKDEPDSPP VALGMVDRSR ILL. It is sometimes possible for the material contained within the vial of "Sterol regulatory element-binding protein 2 (Srebf2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.