3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2) Recombinant Protein | ST5AR2 recombinant protein
Recombinant Pig 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2)
Gene Names
ST5AR2; S5AR 2; Srd5a2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2); Recombinant Pig 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2); Recombinant 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2 EC= 1.3.99.5; 5 alpha-SR2 SR type 2 Steroid 5-alpha-reductase 2; S5AR 2; ST5AR2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-254
Sequence
MPVRCQQSPVLAGSATLAALGALALYFAEPSGYGKYTESLTPAAIRLPARAAWFLQELPSFVVPAGILAGQPRSLFGPPATVLLGLFCAHYFHRTFVYSLLTRGRPFPVVFLFRGFVFCMGNGLLQGYYLVYCAEYPAEWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEVIYKIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYVKMFEDYPKSRKALIPFIF
Sequence Length
254
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,536 Da
NCBI Official Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 2
NCBI Official Symbol
ST5AR2
NCBI Official Synonym Symbols
S5AR 2; Srd5a2
NCBI Protein Information
3-oxo-5-alpha-steroid 4-dehydrogenase 2; SR type 2; 5 alpha-SR2
UniProt Protein Name
3-oxo-5-alpha-steroid 4-dehydrogenase 2
UniProt Gene Name
SRD5A2
UniProt Synonym Gene Names
ST5AR2; S5AR 2
UniProt Entry Name
S5A2_PIG
Uniprot Description
Function: Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology
By similarity.
Catalytic activity: 5-alpha-pregnan-3,20-dione + NADP+ = progesterone + NADPH.
Subcellular location: Microsome membrane; Multi-pass membrane protein
By similarity. Endoplasmic reticulum membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the steroid 5-alpha reductase family.
Similar Products
Product Notes
The ST5AR2 srd5a2 (Catalog #AAA1184036) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-254. The amino acid sequence is listed below: MPVRCQQSPV LAGSATLAAL GALALYFAEP SGYGKYTESL TPAAIRLPAR AAWFLQELPS FVVPAGILAG QPRSLFGPPA TVLLGLFCAH YFHRTFVYSL LTRGRPFPVV FLFRGFVFCM GNGLLQGYYL VYCAEYPAEW YTDIRFSLGV FLFILGMGIN IHSDYILRQL RKPGEVIYKI PQGGLFTYVS GANFLGEIIE WIGYALATWS LPALAFAFFS LCFLGLRAFH HHRFYVKMFE DYPKSRKALI PFIF. It is sometimes possible for the material contained within the vial of "3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
