Speedy protein C (SPDYC) Recombinant Protein | SPDYC recombinant protein
Recombinant Human Speedy protein C (SPDYC)
Gene Names
SPDYC; RINGOC; Ringo2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Speedy protein C (SPDYC); Recombinant Human Speedy protein C (SPDYC); SPDYC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-293, Full length protein
Sequence
MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLANDMEEDLEGPKCEIFPWALGKDWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFHWAWTRDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSLTSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH
Sequence Length
293
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,166 Da
NCBI Official Full Name
speedy protein C
NCBI Official Synonym Full Names
speedy/RINGO cell cycle regulator family member C
NCBI Official Symbol
SPDYC
NCBI Official Synonym Symbols
RINGOC; Ringo2
NCBI Protein Information
speedy protein C
UniProt Protein Name
Speedy protein C
Protein Family
UniProt Gene Name
SPDYC
UniProt Synonym Gene Names
RINGO C; hSpy/Ringo C
Uniprot Description
Promotes progression through the cell cycle via binding and activation of CDK1 and CDK2. Involved in the spindle-assembly checkpoint. Required for recruitment of MAD2L1, BUBR1 and BUB1 to kinetochores. Required for the correct localization of the active form of Aurora B in prometaphase.
Research Articles on SPDYC
Similar Products
Product Notes
The SPDYC spdyc (Catalog #AAA1472534) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-293, Full length protein. The amino acid sequence is listed below: MLWAIPELGS PCPISISYEM SDSQDPTTSP VVTTQVELGG CSRQGGGNGF LRFRQHQEVQ AFLSLLEDSF VQEFLSKDPC FQISDKYLLA MVLVYFQRAH LKLSEYTHSS LFLALYLAND MEEDLEGPKC EIFPWALGKD WCLRVGKFLH QRDKLWARMG FRAVVSRQCC EEVMAKEPFH WAWTRDRRPH HGGVQRVCPQ VPVRLPRGPG LSPPHCSPCG LPQHCSSHLL KPVSSKCPSL TSECHRPPSQ NYLSRVKNAW GGDFLIVLPP QMQLEPGTYS LRIFPKPPAR PGH. It is sometimes possible for the material contained within the vial of "Speedy protein C (SPDYC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
