Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transcription factor SOX-7 (Sox7) Recombinant Protein | Sox7 recombinant protein

Recombinant Mouse Transcription factor SOX-7 (Sox7)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor SOX-7 (Sox7); Recombinant Mouse Transcription factor SOX-7 (Sox7); Sox7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-380, Full length protein
Sequence
MASLLGAYPWTEGLECPALEAELSDGLSPPAVPRPSGDKSSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQGKRLCKRVDPGFLLSSLSRDQNTLPEKNGIGRGEKEDRGEYSPGATLPGLHSCYREGAAAAPGSVDTYPYGLPTPPEMSPLDALEPEQTFFSSSCQEEHGHPHHLPHLPGPPYSPEFTPSPLHCSHPLGSLALGQSPGVSMMSSVSGCPPSPAYYSHATYHPLHPNLQAHLGQLSPPPEHPGFDTLDQLSQVELLGDMDRNEFDQYLNTPGHPDSAAGVGTLTGHVPLSQGTPTGPTETSLISVLADATATYYNSYSVS
Sequence Length
380
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Sox7 recombinant protein
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,489 Da
NCBI Official Full Name
transcription factor SOX-7
NCBI Official Synonym Full Names
SRY (sex determining region Y)-box 7
NCBI Official Symbol
Sox7
NCBI Protein Information
transcription factor SOX-7
UniProt Protein Name
Transcription factor SOX-7
Protein Family
UniProt Gene Name
Sox7
UniProt Synonym Gene Names
Sox-7; mSOX7

Uniprot Description

Binds to and activates the CDH5 promoter, hence plays a role in the transcriptional regulation of genes expressed in the hemogenic endothelium and blocks further differentiation into blood precursors. May be required for the survival of both hematopoietic and endothelial precursors during specification. May play a role in skeletal myogenesis and up-regulate the expression of muscle markers, such as PAX3/PAX7 and Meox1. Competes with GATA4 for binding and activation of the FGF3 promoter. Represses Wnt/beta-catenin-stimulated transcription. Probably acts by targeting CTNNB1 to proteasomal degradation. Binds the DNA sequence 5'-AACAAT-3'.

Research Articles on Sox7

Similar Products

Product Notes

The Sox7 sox7 (Catalog #AAA965219) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-380, Full length protein. The amino acid sequence is listed below: MASLLGAYPW TEGLECPALE AELSDGLSPP AVPRPSGDKS SESRIRRPMN AFMVWAKDER KRLAVQNPDL HNAELSKMLG KSWKALTLSQ KRPYVDEAER LRLQHMQDYP NYKYRPRRKK QGKRLCKRVD PGFLLSSLSR DQNTLPEKNG IGRGEKEDRG EYSPGATLPG LHSCYREGAA AAPGSVDTYP YGLPTPPEMS PLDALEPEQT FFSSSCQEEH GHPHHLPHLP GPPYSPEFTP SPLHCSHPLG SLALGQSPGV SMMSSVSGCP PSPAYYSHAT YHPLHPNLQA HLGQLSPPPE HPGFDTLDQL SQVELLGDMD RNEFDQYLNT PGHPDSAAGV GTLTGHVPLS QGTPTGPTET SLISVLADAT ATYYNSYSVS. It is sometimes possible for the material contained within the vial of "Transcription factor SOX-7 (Sox7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.