Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Superoxide dismutase [Mn], mitochondrial (SOD2) Recombinant Protein | SOD2 recombinant protein

Recombinant Guinea pig Superoxide dismutase [Mn], mitochondrial (SOD2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Superoxide dismutase [Mn]; mitochondrial (SOD2); Recombinant Guinea pig Superoxide dismutase [Mn]; Recombinant Superoxide dismutase [Mn]; mitochondrial EC= 1.15.1.1; SOD2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-211aa; Full length protein
Sequence
KHSLPDLPYDYGALQPHINAEIMQLHHSKHHAAYLNNLNIAEEKYQEALAKGDVTAQVAL QPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAVSVGVQG SGWGWLGFNKERGCLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQLKNVRPDYLKAI WKVIKNS
Sequence Length
211
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for SOD2 recombinant protein
This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
23,236 Da
NCBI Official Full Name
Superoxide dismutase
UniProt Protein Name
Superoxide dismutase [Mn], mitochondrial
Protein Family
UniProt Gene Name
SOD2
UniProt Entry Name
SODM_CAVPO

Uniprot Description

Function: Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.

Catalytic activity: 2 superoxide + 2 H+ = O2 + H2O2.

Cofactor: Binds 1 manganese ion per subunit

By similarity.

Subunit structure: Homotetramer

By similarity.

Subcellular location: Mitochondrion matrix.

Post-translational modification: Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity

By similarity.

Sequence similarities: Belongs to the iron/manganese superoxide dismutase family.

Similar Products

Product Notes

The Superoxide dismutase [Mn], mitochondrial (SOD2) sod2 (Catalog #AAA963095) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-211aa; Full length protein. The amino acid sequence is listed below: KHSLPDLPYD YGALQPHINA EIMQLHHSKH HAAYLNNLNI AEEKYQEALA KGDVTAQVAL QPALKFNGGG HINHSIFWTN LSPNGGGEPK GELLEAIKRD FGSFDKFKEK LTAVSVGVQG SGWGWLGFNK ERGCLQIAAC SNQDPLQGTT GLIPLLGIDV WEHAYYLQLK NVRPDYLKAI WKVIKNS. It is sometimes possible for the material contained within the vial of "Superoxide dismutase [Mn], mitochondrial (SOD2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.