Structural maintenance of chromosomes protein 3 (Smc3) Recombinant Protein | Smc3 recombinant protein
Recombinant Rat Structural maintenance of chromosomes protein 3 (Smc3) , partial
Gene Names
Smc3; Cspg6; SMC-3; bamacan
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Structural maintenance of chromosomes protein 3 (Smc3); Recombinant Rat Structural maintenance of chromosomes protein 3 (Smc3); partial; Smc3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
466-713aa; Partial
Sequence
QSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINNEIDQ
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Smc3 recombinant protein
This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
138,448 Da
NCBI Official Full Name
Structural maintenance of chromosomes protein 3
NCBI Official Synonym Full Names
structural maintenance of chromosomes 3
NCBI Official Symbol
Smc3
NCBI Official Synonym Symbols
Cspg6; SMC-3; bamacan
NCBI Protein Information
structural maintenance of chromosomes protein 3
UniProt Protein Name
Structural maintenance of chromosomes protein 3
UniProt Gene Name
Smc3
UniProt Synonym Gene Names
Bam; Bmh; Cspg6; Smc3l1; SMC protein 3; SMC-3; Bamacan
NCBI Description
core protein of a chondroitin sulfate proteoglycan that is a component of basement membranes [RGD, Feb 2006]
Uniprot Description
Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement ().
Research Articles on Smc3
Similar Products
Product Notes
The Smc3 smc3 (Catalog #AAA949997) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 466-713aa; Partial. The amino acid sequence is listed below: QSERNYLWRE ENAEQQALAA KREDLEKKQQ LLRAATGKAI LNGIDSINKV LDHFRRKGIN QHVQNGYHGI VMNNFECEPA FYTCVEVTAG NRLFYHIVDS DEVSTKILME FNKMNLPGEV TFLPLNKLDV RDTAYPETND AIPMISKLRY NPRFDKAFKH VFGKTLICRS MEVSTQLARA FTMDCITLEG DQVSHRGALT GGYYDTRKSR LELQKDVRKA EEELGELEAK LNENLRRNIE RINNEIDQ . It is sometimes possible for the material contained within the vial of "Structural maintenance of chromosomes protein 3 (Smc3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
