Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium-binding mitochondrial carrier protein SCaMC-2-B (slc25a25b) Recombinant Protein | slc25a25b recombinant protein

Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-2-B (slc25a25b)

Gene Names
slc25a25b; scamc2b; si:dkey-7o20.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-binding mitochondrial carrier protein SCaMC-2-B (slc25a25b); Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-2-B (slc25a25b); Recombinant Calcium-binding mitochondrial carrier protein SCaMC-2-B (slc25a25b); Calcium-binding mitochondrial carrier protein SCaMC-2-B; Small calcium-binding mitochondrial carrier protein 2-B Solute carrier family 25 member 25-B; slc25a25b recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-469
Sequence
MLCLCLYVPVHISERTEFEYFESESLPVQLKSLFKLSLFLPSQEFDSYRKWRKKVVKAGDKDLDGQLDFEEFVHYLRDHEKKLRLVFKSLDKKNDGHIDSQEIMQSLRDLGVHISEEQAEKILKSMDKNGTMTIDWNEWRDYHLLHPAENIPEIILYWKHSTIFDVGESMLVPDEFTAEEKNTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHATRSNSMGIAGGFTQMIREGGLRSLWRGNGINVLKIAPESAIKFMAYEQIKRLIGSNQETLGILERLVSGSLAGAIAQSSIYPMEVLKTRLALGRTGQYSGIADCAKHIFKKEGMTAFYKGYIPNMLGIIPYAGIDLAVYETLKNSWLQRFATDSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASQEGSPQMTMSGLFRHIVRTEGAIGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Sequence Length
469
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,712 Da
NCBI Official Full Name
calcium-binding mitochondrial carrier protein SCaMC-2-B
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25b
NCBI Official Symbol
slc25a25b
NCBI Official Synonym Symbols
scamc2b; si:dkey-7o20.1
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-2-B; solute carrier family 25, member 25; solute carrier family 25 member 25-B; small calcium-binding mitochondrial carrier 2; small calcium-binding mitochondrial carrier protein 2-B
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-2-B
UniProt Gene Name
slc25a25b
UniProt Synonym Gene Names
scamc2b
UniProt Entry Name
SCM2B_DANRE

Uniprot Description

Function: Calcium-dependent mitochondrial solute carrier

By similarity.

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the mitochondrial carrier family.Contains 3 EF-hand domains.Contains 3 Solcar repeats.

Similar Products

Product Notes

The slc25a25b slc25a25b (Catalog #AAA1011805) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-469. The amino acid sequence is listed below: MLCLCLYVPV HISERTEFEY FESESLPVQL KSLFKLSLFL PSQEFDSYRK WRKKVVKAGD KDLDGQLDFE EFVHYLRDHE KKLRLVFKSL DKKNDGHIDS QEIMQSLRDL GVHISEEQAE KILKSMDKNG TMTIDWNEWR DYHLLHPAEN IPEIILYWKH STIFDVGESM LVPDEFTAEE KNTGMWWRHL VAGGGAGAVS RTCTAPLDRL KVLMQVHATR SNSMGIAGGF TQMIREGGLR SLWRGNGINV LKIAPESAIK FMAYEQIKRL IGSNQETLGI LERLVSGSLA GAIAQSSIYP MEVLKTRLAL GRTGQYSGIA DCAKHIFKKE GMTAFYKGYI PNMLGIIPYA GIDLAVYETL KNSWLQRFAT DSADPGVFVL LACGTMSSTC GQLASYPLAL VRTRMQAQAS QEGSPQMTMS GLFRHIVRTE GAIGLYRGLA PNFMKVIPAV SISYVVYENL KITLGVQSR. It is sometimes possible for the material contained within the vial of "Calcium-binding mitochondrial carrier protein SCaMC-2-B (slc25a25b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.