SDS-PAGE
Excitatory amino acid transporter 4 Recombinant Protein | SLC1A6 recombinant protein
Recombinant Human Excitatory amino acid transporter 4
Gene Names
SLC1A6; EAAT4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Excitatory amino acid transporter 4; Recombinant Human Excitatory amino acid transporter 4; Sodium-dependent glutamate/aspartate transporter; Solute carrier family 1 member 6; SLC1A6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
149-271aa; Partial
Sequence
MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL
Sequence Length
312
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for SLC1A6 recombinant protein
Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium.
Product Categories/Family for SLC1A6 recombinant protein
References
"An excitatory amino-acid transporter with properties of a ligand-gated chloride channel." Fairman W.A., Vandenberg R.J., Arriza J.L., Kavanaugh M.P., Amara S.G. Nature 375:599-603(1995)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40.4 kDa
NCBI Official Full Name
excitatory amino acid transporter 4 isoform 1
NCBI Official Synonym Full Names
solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
NCBI Official Symbol
SLC1A6
NCBI Official Synonym Symbols
EAAT4
NCBI Protein Information
excitatory amino acid transporter 4
UniProt Protein Name
Excitatory amino acid transporter 4
Protein Family
UniProt Gene Name
SLC1A6
UniProt Synonym Gene Names
EAAT4
UniProt Entry Name
EAA4_HUMAN
Uniprot Description
SLC1A6: Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium. Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A6 subfamily.
Protein type: Transporter; Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral
Chromosomal Location of Human Ortholog: 19p13.12
Cellular Component: Golgi apparatus; integral to plasma membrane; membrane; plasma membrane
Molecular Function: L-aspartate transmembrane transporter activity; L-glutamate transmembrane transporter activity; sodium:dicarboxylate symporter activity
Biological Process: aspartate transport; glutamate secretion; ion transport; L-glutamate transport; neurotransmitter secretion; regulation of membrane potential; synaptic transmission; transmembrane transport
Research Articles on SLC1A6
Similar Products
Product Notes
The SLC1A6 slc1a6 (Catalog #AAA956085) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 149-271aa; Partial. The amino acid sequence is listed below: MVTIIHPGKG SKEGLHREGR IETIPTADAF MDLIRNMFPP NLVEACFKQF KTQYSTRVVT RTMVRTENGS EPGASMPPPF SVENGTSFLE NVTRALGTLQ EMLSFEETVP VPGSANGINA LGL. It is sometimes possible for the material contained within the vial of "Excitatory amino acid transporter 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
