SDS-PAGE
Epididymal secretory protein E1 Recombinant Protein | NPC2 recombinant protein
Recombinant Canis familiaris (Dog) Epididymal secretory protein E1
Gene Names
NPC2; CE1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Epididymal secretory protein E1; Recombinant Canis familiaris (Dog) Epididymal secretory protein E1; Niemann Pick type C2 protein homolog; cE1; NPC2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-149aa; Full Length
Sequence
VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG
Sequence Length
149
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for NPC2 recombinant protein
Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting membrane of late endosomes/ lysosomes to the ER and plasma membrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport.
References
Gene expression in the dog epididymis a model for human epididymal function.Ellerbrock K., Pera I., Hartung S., Ivell R.Int. J. Androl. 17:314-323(1994)
Regional variation of specific gene expression in the dog epididymis as revealed by in-situ transcript hybridization.Pera I., Ivell R., Kirchhoff C.Int. J. Androl. 17:324-330(1994)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
16 kDa
NCBI Official Full Name
Epididymal secretory protein E1
NCBI Official Symbol
NPC2
NCBI Official Synonym Symbols
CE1
NCBI Protein Information
epididymal secretory protein E1
UniProt Protein Name
Epididymal secretory protein E1
Protein Family
UniProt Gene Name
NPC2
UniProt Entry Name
NPC2_CANLF
Uniprot Description
Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting membrane of late endosomes/ lysosomes to the ER and plasma membrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport ().
Similar Products
Product Notes
The NPC2 npc2 (Catalog #AAA1319431) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-149aa; Full Length. The amino acid sequence is listed below: VHFKDCGSAV GVIKELNVNP CPAQPCKLHK GQSYSVNVTF TSNIPSQSSK AVVHGIVLGV AVPFPIPEAD GCKSGINCPI QKDKTYSYLN KLPVKNEYPS IKLVVQWMLL GDNNQHLFCW EIPVQIEG. It is sometimes possible for the material contained within the vial of "Epididymal secretory protein E1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
