Ileal sodium/bile acid cotransporter (Slc10a2) Recombinant Protein | Slc10a2 recombinant protein
Recombinant Mouse Ileal sodium/bile acid cotransporter (Slc10a2)
Gene Names
Slc10a2; ASBT; ISBT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ileal sodium/bile acid cotransporter (Slc10a2); Recombinant Mouse Ileal sodium/bile acid cotransporter (Slc10a2); Recombinant Ileal sodium/bile acid cotransporter (Slc10a2); Ileal sodium/bile acid cotransporter; Apical sodium-dependent bile acid transporter; ASBT Ileal Na(+)/bile acid cotransporter Ileal sodium-dependent bile acid transporter; IBAT; ISBT Na(+)-depend; Slc10a2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-348
Sequence
MDNSSVCPPNATVCEGDSCVVPESNFNAILNTVMSTVLTILLAMVMFSMGCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGMFVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNKGFQPDEK
Sequence Length
348
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,134 Da
NCBI Official Full Name
ileal sodium/bile acid cotransporter
NCBI Official Synonym Full Names
solute carrier family 10, member 2
NCBI Official Symbol
Slc10a2
NCBI Official Synonym Symbols
ASBT; ISBT
NCBI Protein Information
ileal sodium/bile acid cotransporter; IBAT; ileal Na(+)/bile acid cotransporter; Na(+)-dependent ileal bile acid transporter; ileal sodium-dependent bile acid transporter; apical sodium-dependent bile acid transporter; sodium/taurocholate cotransporting polypeptide, ileal
UniProt Protein Name
Ileal sodium/bile acid cotransporter
Protein Family
UniProt Gene Name
Slc10a2
UniProt Synonym Gene Names
Ntcp2; ASBT; IBAT; ISBT
UniProt Entry Name
NTCP2_MOUSE
Uniprot Description
ASBT: Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. Plays a key role in cholesterol metabolism. Defects in SLC10A2 are a cause of primary bile acid malabsorption (PBAM). PBAM is an idiopathic intestinal disorder associated with congenital diarrhea, steatorrhea, interruption of the enterohepatic circulation of bile acids, and reduced plasma cholesterol levels. Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter
Cellular Component: proteasome complex; microvillus; membrane; integral to plasma membrane; apical plasma membrane; integral to membrane; nucleus
Molecular Function: bile acid:sodium symporter activity; symporter activity
Biological Process: bile acid and bile salt transport; transport; sodium ion transport; ion transport
Research Articles on Slc10a2
Similar Products
Product Notes
The Slc10a2 slc10a2 (Catalog #AAA951960) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-348. The amino acid sequence is listed below: MDNSSVCPPN ATVCEGDSCV VPESNFNAIL NTVMSTVLTI LLAMVMFSMG CNVEVHKFLG HIKRPWGIFV GFLCQFGIMP LTGFILSVAS GILPVQAVVV LIMGCCPGGT GSNILAYWID GDMDLSVSMT TCSTLLALGM MPLCLFVYTK MWVDSGTIVI PYDSIGISLV ALVIPVSFGM FVNHKWPQKA KIILKIGSIT GVILIVLIAV IGGILYQSAW IIEPKLWIIG TIFPIAGYSL GFFLARLAGQ PWYRCRTVAL ETGMQNTQLC STIVQLSFSP EDLNLVFTFP LIYTVFQLVF AAVILGIYVT YRKCYGKNDA EFLEKTDNEM DSRPSFDETN KGFQPDEK. It is sometimes possible for the material contained within the vial of "Ileal sodium/bile acid cotransporter (Slc10a2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
