Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human SIRPG/SIRPB2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SIRPG/SIRPB2 Recombinant Protein | SIRPG recombinant protein

Recombinant Human SIRPG/SIRPB2 Protein

Gene Names
SIRPG; CD172g; SIRPB2; SIRP-B2; bA77C3.1; SIRPgamma
Purity
>95% by SDS-PAGE.
Synonyms
SIRPG/SIRPB2; Recombinant Human SIRPG/SIRPB2 Protein; Signal-Regulatory Protein Gamma; SIRP-Gamma; CD172 Antigen-Like Family Member B; Signal-Fegulatory Protein Beta-2; SIRP-b2; SIRP-Beta-2; CD172g; SIRPG; SIRPB2; SIRPG recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Sequence
EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQL
Sequence Length
276
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human SIRPG/SIRPB2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human SIRPG/SIRPB2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for SIRPG recombinant protein
Description: Recombinant Human SIRPG/SIRPB2 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Glu29-Pro360) of human SIRPG/SIRPB2 (Accession #Q9P1W8) fused with an Fc tag at the C-terminus.

Background: Signal-Regulatory Protein Gamma (SIRPG) is a member of the signal-regulatory protein (SIRP) family and alsobelongs to the immunoglobulin superfamily. SIRPG is detected in the liver, and at very low levels in the brain,heart, lung, pancreas, kidney, placenta, and skeletal muscle. SIRPG is an immunoglobulin-like cell surfacereceptor. On binding with CD47, SIRPG mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation.SIRPG as receptor-type transmembrane glycoproteins is involved in the negative regulation of receptortyrosine kinase-coupled signaling processes.
Product Categories/Family for SIRPG recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
signal-regulatory protein gamma isoform 3
NCBI Official Synonym Full Names
signal regulatory protein gamma
NCBI Official Symbol
SIRPG
NCBI Official Synonym Symbols
CD172g; SIRPB2; SIRP-B2; bA77C3.1; SIRPgamma
NCBI Protein Information
signal-regulatory protein gamma
UniProt Protein Name
Signal-regulatory protein gamma
Protein Family
UniProt Gene Name
SIRPG
UniProt Synonym Gene Names
SIRPB2; SIRP-gamma; SIRP-b2; SIRP-beta-2
UniProt Entry Name
SIRPG_HUMAN

NCBI Description

The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

SIRPG: Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T- cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation; cell-cell signaling; positive regulation of cell proliferation; positive regulation of cell-cell adhesion; positive regulation of T cell activation; cell adhesion; blood coagulation; leukocyte migration

Research Articles on SIRPG

Similar Products

Product Notes

The SIRPG sirpg (Catalog #AAA9140046) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EEELQMIQPE KLLLVTVGKT ATLHCTVTSL LPVGPVLWFR GVGPGRELIY NQKEGHFPRV TTVSDLTKRN NMDFSIRISS ITPADVGTYY CVKFRKGSPE NVEFKSGPGT EMALGAKPSA PVVLGPAART TPEHTVSFTC ESHGFSPRDI TLKWFKNGNE LSDFQTNVDP TGQSVAYSIR STARVVLDPW DVRSQVICEV AHVTLQGDPL RGTANLSEAI RVPPTLEVTQ QPMRVGNQVN VTCQVRKFYP QSLQL. It is sometimes possible for the material contained within the vial of "SIRPG/SIRPB2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.