Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Probable E3 ubiquitin-protein ligase sinah (sinah) Recombinant Protein | sinah recombinant protein

Recombinant Drosophila melanogaster Probable E3 ubiquitin-protein ligase sinah (sinah)

Gene Names
sinah; anon-WO0140519.228; CG13030; DmelCG13030; sina-h; SinaH
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable E3 ubiquitin-protein ligase sinah (sinah); Recombinant Drosophila melanogaster Probable E3 ubiquitin-protein ligase sinah (sinah); sinah recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-351, Full length protein
Sequence
MSVRNSRPQLSWPERVSPQRTIDTPTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPDAAAAGELVPSRRKDSVAVQSGIVATGPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENFSSFTNADFLVLNKHTVELFSEDGNLALNVVIRKVEERTN
Sequence Length
351
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,645 Da
NCBI Official Full Name
sina homologue
NCBI Official Synonym Full Names
sina homologue
NCBI Official Symbol
sinah
NCBI Official Synonym Symbols
anon-WO0140519.228; CG13030; DmelCG13030; sina-h; SinaH
NCBI Protein Information
CG13030 gene product from transcript CG13030-RC
UniProt Protein Name
Probable E3 ubiquitin-protein ligase sinah
UniProt Gene Name
sinah

Uniprot Description

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. The adapter phyl is required to direct the degradation of the two isoforms of the transcriptional repressor Tramtrack (Ttk). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates. A phyl-independent mechanism of degradation exists for isoform beta of ttk that involves motifs in the C-terminus of ttk.

Research Articles on sinah

Similar Products

Product Notes

The sinah sinah (Catalog #AAA1287333) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-351, Full length protein. The amino acid sequence is listed below: MSVRNSRPQL SWPERVSPQR TIDTPTASGE MLTRRQSAPA LVVPPEETTH VVVVKRQSPD AAAAGELVPS RRKDSVAVQS GIVATGPLDT TRSGARDDFL MALLECPVCF GYIMPPIMQC PRGHLICSTC RSKLTICPVC RVFMTNIRSL AMEKVASKLI FPCKHSHFGC RARLSYAEKT KHEEDCECRP YFCPYPDDKC SWQGPLRDVY QHLMSSHENV ITMEGNDIIF LATNVNLEGA LDWTMVQSCH GRHFLLSLEK INLGEDCQQY FTACRMIGSM KDAAEFVYNI SLEAYNRTLR WQSKPRSIRE NFSSFTNADF LVLNKHTVEL FSEDGNLALN VVIRKVEERT N. It is sometimes possible for the material contained within the vial of "Probable E3 ubiquitin-protein ligase sinah (sinah), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual