CD329 recombinant protein

CD329 Recombinant Protein

Cat. Num. AAA3016012

• Gene Names: SIGLEC9; CD329; CDw329; FOAP-9; siglec-9; OBBP-LIKE
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Synonyms: CD329; CD329 Recombinant Protein; CD329 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Sequence: SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDT

• Restriction Site: NdeI-XhoI
• Expression Vector: pet-22b(+)
• Preparation and Storage: Store at 4 degree C short term. Aliquot and store at -20 degree C long term. Avoid freeze-thaw cycles.

Testing Data

Related Product Information for CD329 recombinant protein

Two families of mammalian lectin-like adhesion molecules bind glycoconjugate ligands in a sialic acid-dependent manner: the selectins and the sialoadhesins. The sialic acid-binding immunoglobulin superfamily lectins, designated siglecs or sialoadhesins, are immunoglobulin superfamily members recognizing sialylated ligands. The common sialic acids of mammalian cells are N-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc). Siglec-1 mediates local cell-cell interactions in lymphoid tissues and can be detected at contact points of macrophages with other macrophages, sinus-lining cells and reticulum cells. Siglec-7, highly expressed in monocytes and resident blood cells but not in parenchymatous cells, mediates inhibition of natural killer cell cytotoxicity. Siglec-9 is closely homologous to Siglec-7. It is highly expressed in peripheral blood leukocytes (not eosinophils), liver, bone marrow, placenta and spleen. Siglec-8, a type I membrane protein, is selectively expressed on human eosinophils, basophils and mast cells, where it regulates their function and survival.

NCBI and Uniprot Product Information

• NCBI GI #: 25009270
• NCBI GeneID: 27180
• UniProt Accession #: Q9Y336; Q6GTU4; Q9BYI9
• Molecular Weight: 52,492 Da
• NCBI Official Full Name: Sialic acid-binding Ig-like lectin 9
• NCBI Official Synonym Full Names: sialic acid binding Ig like lectin 9
• NCBI Official Symbol: SIGLEC9
• NCBI Official Synonym Symbols: CD329; CDw329; FOAP-9; siglec-9; OBBP-LIKE
• NCBI Protein Information: sialic acid-binding Ig-like lectin 9
• UniProt Protein Name: Sialic acid-binding Ig-like lectin 9
• UniProt Gene Name: SIGLEC9
• UniProt Synonym Gene Names: Siglec-9

Uniprot Description

Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.