Testing Data
CD327 recombinant protein
CD327 Recombinant Protein
Gene Names
SIGLEC6; CD327; CD33L; OBBP1; CD33L1; CD33L2; CDW327
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Synonyms
CD327; CD327 Recombinant Protein; CD327 recombinant protein
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Sequence
QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV
Restriction Site
NdeI-XhoI
Expression Vector
pet-22b(+)
Preparation and Storage
Store at 4 degree C short term. Aliquot and store at -20 degree C long term. Avoid freeze-thaw cycles.
Testing Data
Testing Data
Related Product Information for CD327 recombinant protein
Two families of mammalian lectin-like adhesion molecules, the selectins and the sialoadhesins, bind glycoconjugate ligands in a sialic acid-dependent manner. The sialic acid-binding immunoglobulin superfamily lectins, designated Siglecs or sialoadhesins, recognize sialylated ligands and play a key role in mediating sialic-acid dependent binding to cells. Siglec-6, also called obesitybinding protein 1, is an adhesion molecule that is highly expressed in placental trophoblasts, as well as in peripheral blood leukocytes. Siglec-6 can bind bothN-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc), the two common sialic acids found in mammalian cells. Together with the other members of the Siglec family, Siglec-6 promotes cell-cell interactions and plays a roll in the innate and adaptive immune systems through glycan recognition.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
44,348 Da
NCBI Official Full Name
Sialic acid-binding Ig-like lectin 6
NCBI Official Synonym Full Names
sialic acid binding Ig like lectin 6
NCBI Official Symbol
SIGLEC6
NCBI Official Synonym Symbols
CD327; CD33L; OBBP1; CD33L1; CD33L2; CDW327
NCBI Protein Information
sialic acid-binding Ig-like lectin 6
UniProt Protein Name
Sialic acid-binding Ig-like lectin 6
UniProt Gene Name
SIGLEC6
UniProt Synonym Gene Names
CD33L; CD33L1; OBBP1; Siglec-6; OB-BP1
NCBI Description
This gene encodes a member of the SIGLEC (sialic acid binding immunoglobulin-like lectin) family of proteins. The encoded transmembrane receptor binds sialyl-TN glycans and leptin. Placental expression of the encoded protein is upregulated in preeclampsia. [provided by RefSeq, Jul 2016]
Uniprot Description
Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
Research Articles on CD327
Similar Products
Product Notes
The CD327 siglec6 (Catalog #AAA3016008) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QERRFQLEGP ESLTVQEGLC VLVPCRLPTT LPASYYGYGY WFLEGADVPV ATNDPDEEVQ EETRGRFHLL WDPRRKNCSL SIRDARRRDN AAYFFRLKSK WMKYGYTSSK LSVRVMALTH RPNISIPGTL ESGHPSNLTC SVPWVCEQGT PPIFSWMSAA PTSLGPRTTQ SSVLTITPRP QDHSTNLTCQ VTFPGAGVTM ERTIQLNVSY APQKVAISIF QGNSAAFKIL QNTSSLPVLE GQALRLLCDA DGNPPAHLSW FQGFPALNAT PISNTGVLEL PQVGSAEEGD FTCRAQHPLG SLQISLSLFV HWKPEGRAGG V. It is sometimes possible for the material contained within the vial of "CD327, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
