Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Sgta) Recombinant Protein | Sgta recombinant protein

Recombinant Rat Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Sgta)

Gene Names
Sgta; Stg
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Sgta); Recombinant Rat Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Sgta); Sgta recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-314, Full length protein
Sequence
MDNRKRLAYAIIQFLHGQLRHGGLSSDAQESLEVAIQCLETAFGVTLEDSDLALPQTLPEIFEAATASKEMPQDPRGPDRTPPSEEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAVAYYKKALELDPDNDTYKSNLKIAELKLREAPSPTGGVGSLDIAGLLNNPHFITMASSLMNSPQLQQLMSGMISGGHNPLGTPGSSPQHSDLASLIQAGQQFAQQMQQQNPEFVEQIRSQVVRSRTPSASHEEQQE
Sequence Length
314
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Sgta recombinant protein
This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 70-kDa heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissues, this protein may serve a housekeeping function.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,157 Da
NCBI Official Full Name
small glutamine-rich tetratricopeptide repeat-containing protein alpha
NCBI Official Synonym Full Names
small glutamine rich tetratricopeptide repeat containing alpha
NCBI Official Symbol
Sgta
NCBI Official Synonym Symbols
Stg
NCBI Protein Information
small glutamine-rich tetratricopeptide repeat-containing protein alpha
UniProt Protein Name
Small glutamine-rich tetratricopeptide repeat-containing protein alpha
UniProt Gene Name
Sgta
UniProt Synonym Gene Names
Sgt; Sgt1; Stg

NCBI Description

binds the parvovirus H-1 nonstructural protein NS1 and may be modified by viral infection [RGD, Feb 2006]

Uniprot Description

Co-chaperone that binds misfolded and hydrophobic patches-containing client proteins in the cytosol. Mediates their targeting to the endoplasmic reticulum but also regulates their sorting to the proteasome when targeting fails. Functions in tail-anchored/type II transmembrane proteins membrane insertion constituting with ASNA1 and the BAG6 complex a targeting module. Probably functions upstream of the BAG6 complex and ASNA1, binding more rapidly the transmembrane domain of newly synthesized proteins. It is also involved in the regulation of the endoplasmic reticulum-associated misfolded protein catabolic process via its interaction with BAG6: collaborates with the BAG6 complex to maintain hydrophobic substrates in non-ubiquitinated states. Competes with RNF126 for interaction with BAG6, preventing the ubiquitination of client proteins associated with the BAG6 complex (). Binds directly to HSC70 and HSP70 and regulates their ATPase activity (PubMed:12878599).

Research Articles on Sgta

Similar Products

Product Notes

The Sgta sgta (Catalog #AAA1013506) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-314, Full length protein. The amino acid sequence is listed below: MDNRKRLAYA IIQFLHGQLR HGGLSSDAQE SLEVAIQCLE TAFGVTLEDS DLALPQTLPE IFEAATASKE MPQDPRGPDR TPPSEEDSAE AERLKTEGNE QMKLENFEAA VHLYGKAIEL NPANAVYFCN RAAAYSKLGN YVGAVQDCER AIGIDPGYSK AYGRMGLALS SLNKHAEAVA YYKKALELDP DNDTYKSNLK IAELKLREAP SPTGGVGSLD IAGLLNNPHF ITMASSLMNS PQLQQLMSGM ISGGHNPLGT PGSSPQHSDL ASLIQAGQQF AQQMQQQNPE FVEQIRSQVV RSRTPSASHE EQQE. It is sometimes possible for the material contained within the vial of "Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Sgta), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.