Surfactant Protein B Recombinant Protein | SFTPB recombinant protein

Recombinant Human Surfactant Protein B

Cat. Num. AAA141371

• Gene Names: SFTPB; SP-B; PSP-B; SFTB3; SFTP3; SMDP1
• Purity: >95.0% as determined by SDS-PAGE
• Synonyms: Surfactant Protein B; Recombinant Human Surfactant Protein B; Surfactant Protein B Human Recombinant; Pulmonary surfactant-associated protein B; SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe); SFTPB; SFTP3; SFTPB Human; SFTPB recombinant protein

• Host: HEK293 Cells
• Purity/Purification: >95.0% as determined by SDS-PAGE
• Form/Format: Filtered White Lyophilized (Freeze-Dried) Powder; Filtered (0.4 um) and lyophilized from 0.5mg/ml solution in PBS and 5% trehalose (w/v), pH 7.4.
• Sequence: WTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLE QECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPL LDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCL AERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQA CVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDLHHHHHH
• Sequence Length: 393

• Solubility: It is recommended to add 200ul deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely.
• Preparation and Storage: Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.; Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.

Related Product Information for SFTPB recombinant protein

Introduction: SFTPB is an amphipathic surfactant protein critical for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which consist of plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. Pulmonary surfactant-associated proteins support alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. The SPB improves the rate of spreading and increases the stability of surfactant monolayers in vitro. SPB increases the collapse pressure of palmitic acid to approximately 70 millinewtons per meter.

Description: SFTPB Human Recombinant is a single, glycosylated polypeptide chain containing 363 amino acids (25-381a.a) and having a molecular mass of 40.4kDa (calculated). SFPTB is fused to a 6 a.a on C-terminal.

Product Categories/Family for SFTPB recombinant protein

Recombinant & Natural Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 288856299
• NCBI GeneID: 6439
• NCBI Accession #: NP_000533.3
• NCBI GenBank Nucleotide #: NM_000542.3
• UniProt Accession #: P07988
• NCBI Official Full Name: pulmonary surfactant-associated protein B
• NCBI Official Synonym Full Names: surfactant protein B
• NCBI Official Symbol: SFTPB
• NCBI Official Synonym Symbols: SP-B; PSP-B; SFTB3; SFTP3; SMDP1
• NCBI Protein Information: pulmonary surfactant-associated protein B
• UniProt Protein Name: Pulmonary surfactant-associated protein B
• Protein Family: Pulmonary surfactant-associated protein
• UniProt Gene Name: SFTPB
• UniProt Synonym Gene Names: SFTP3; SP-B
• UniProt Entry Name: PSPB_HUMAN

NCBI Description

This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.[provided by RefSeq, Feb 2010]

Uniprot Description

SFTPB: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air- liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. Defects in SFTPB are the cause of pulmonary surfactant metabolism dysfunction type 1 (SMDP1); also called pulmonary alveolar proteinosis due to surfactant protein B deficiency. A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid- Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress. Genetic variations in SFTPB are a cause of susceptibility to respiratory distress syndrome in premature infants (RDS). RDS is a lung disease affecting usually premature newborn infants. It is characterized by deficient gas exchange, diffuse atelectasis, high-permeability lung edema and fibrin-rich alveolar deposits called 'hyaline membranes'. A variation Ile to Thr at position 131 influences the association between specific alleles of SFTPA1 and respiratory distress syndrome in premature infants.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2p12-p11.2

Cellular Component: extracellular space; lysosome

Biological Process: organ morphogenesis; sphingolipid metabolic process; respiratory gaseous exchange

Disease: Surfactant Metabolism Dysfunction, Pulmonary, 1