Pulmonary surfactant-associated protein B (SFTPB) Recombinant Protein | SFTPB recombinant protein

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB), partial

Cat. Num. AAA7053533

• Gene Names: SFTPB; SP-B; PSP-B; SFTB3; SFTP3; SMDP1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Pulmonary surfactant-associated protein B (SFTPB); Recombinant Human Pulmonary surfactant-associated protein B (SFTPB); partial; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe); SFTPB recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 201-279. Full Length of Mature Protein
• Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

• Species: Homo sapiens(Human)
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.

SDS-PAGE

Related Product Information for SFTPB recombinant protein

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Product Categories/Family for SFTPB recombinant protein

Cell Biology; Transmembrane Protein

References

"cDNA and deduced amino acid sequence of human pulmonary surfactant-associated proteolipid SPL(Phe)." Glasser S.W., Korfhagen T.R., Weaver T., Pilot-Matias T., Fox J.L., Whitsett J.A. Proc. Natl. Acad. Sci. U.S.A. 84:4007-4011(1987)

NCBI and Uniprot Product Information

• NCBI GI #: 288856299
• NCBI GeneID: 6439
• NCBI Accession #: NP_000533.3
• NCBI GenBank Nucleotide #: NM_000542.3
• UniProt Accession #: P07988; Q96R04
• Molecular Weight: 24.7 kDa
• NCBI Official Full Name: pulmonary surfactant-associated protein B
• NCBI Official Synonym Full Names: surfactant protein B
• NCBI Official Symbol: SFTPB
• NCBI Official Synonym Symbols: SP-B; PSP-B; SFTB3; SFTP3; SMDP1
• NCBI Protein Information: pulmonary surfactant-associated protein B
• UniProt Protein Name: Pulmonary surfactant-associated protein B
• Protein Family: Pulmonary surfactant-associated protein
• UniProt Gene Name: SFTPB
• UniProt Synonym Gene Names: SFTP3; SP-B

NCBI Description

This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.[provided by RefSeq, Feb 2010]

Uniprot Description

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.