Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Pulmonary surfactant-associated protein A (Sftpa1) Recombinant Protein | Sftpa1 recombinant protein

Recombinant Rat Pulmonary surfactant-associated protein A (Sftpa1)

Gene Names
Sftpa1; PSAP; SP-A; PSP-A; Sftp1; Sftpa; Sftpl
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pulmonary surfactant-associated protein A (Sftpa1); Recombinant Rat Pulmonary surfactant-associated protein A (Sftpa1); Sftpa1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-248, full length protein
Sequence
NVTDVCAGSPGIPGAPGNHGLPGRDGRDGVKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGERGDKGEPGERGLPGFPAYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGDFHYLDGASVNYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF
Sequence Length
228
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,289 Da
NCBI Official Full Name
pulmonary surfactant-associated protein A isoform 1
NCBI Official Synonym Full Names
surfactant protein A1
NCBI Official Symbol
Sftpa1
NCBI Official Synonym Symbols
PSAP; SP-A; PSP-A; Sftp1; Sftpa; Sftpl
NCBI Protein Information
pulmonary surfactant-associated protein A
UniProt Protein Name
Pulmonary surfactant-associated protein A
UniProt Gene Name
Sftpa1
UniProt Synonym Gene Names
Sftp-1; Sftp1; Sftpa; PSAP; PSP-A; SP-A

NCBI Description

binds LPS and modifies LPS-induced immune cell activation in the lung [RGD, Feb 2006]

Uniprot Description

In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.

Research Articles on Sftpa1

Similar Products

Product Notes

The Sftpa1 sftpa1 (Catalog #AAA1097952) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-248, full length protein. The amino acid sequence is listed below: NVTDVCAGSP GIPGAPGNHG LPGRDGRDGV KGDPGPPGPM GPPGGMPGLP GRDGLPGAPG APGERGDKGE PGERGLPGFP AYLDEELQTE LYEIKHQILQ TMGVLSLQGS MLSVGDKVFS TNGQSVNFDT IKEMCTRAGG NIAVPRTPEE NEAIASIAKK YNNYVYLGMI EDQTPGDFHY LDGASVNYTN WYPGEPRGQG KEKCVEMYTD GTWNDRGCLQ YRLAVCEF. It is sometimes possible for the material contained within the vial of "Pulmonary surfactant-associated protein A (Sftpa1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual