Pulmonary surfactant-associated protein A (Sftpa1) Recombinant Protein | Sftpa1 recombinant protein

Recombinant Rat Pulmonary surfactant-associated protein A (Sftpa1)

Cat. Num. AAA1097952

• Gene Names: Sftpa1; PSAP; SP-A; PSP-A; Sftp1; Sftpa; Sftpl
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Pulmonary surfactant-associated protein A (Sftpa1); Recombinant Rat Pulmonary surfactant-associated protein A (Sftpa1); Sftpa1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-248, full length protein
• Sequence: NVTDVCAGSPGIPGAPGNHGLPGRDGRDGVKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGERGDKGEPGERGLPGFPAYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGDFHYLDGASVNYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF
• Sequence Length: 228

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 397174794
• NCBI GeneID: 24773
• NCBI Accession #: NP_001257574.1
• NCBI GenBank Nucleotide #: NM_001270645.1
• UniProt Accession #: P08427
• Molecular Weight: 26,289 Da
• NCBI Official Full Name: pulmonary surfactant-associated protein A isoform 1
• NCBI Official Synonym Full Names: surfactant protein A1
• NCBI Official Symbol: Sftpa1
• NCBI Official Synonym Symbols: PSAP; SP-A; PSP-A; Sftp1; Sftpa; Sftpl
• NCBI Protein Information: pulmonary surfactant-associated protein A
• UniProt Protein Name: Pulmonary surfactant-associated protein A
• Protein Family: Pulmonary surfactant-associated protein
• UniProt Gene Name: Sftpa1
• UniProt Synonym Gene Names: Sftp-1; Sftp1; Sftpa; PSAP; PSP-A; SP-A

NCBI Description

binds LPS and modifies LPS-induced immune cell activation in the lung [RGD, Feb 2006]

Uniprot Description

In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.