Serpin B3 (SERPINB3) Recombinant Protein | SERPINB3 recombinant protein
Recombinant Human Serpin B3 (SERPINB3)
Gene Names
SERPINB3; SCC; T4-A; SCCA1; SCCA-1; HsT1196; SCCA-PD
Purity
>=90%
Synonyms
Serpin B3 (SERPINB3); Recombinant Human Serpin B3 (SERPINB3); Serpin B3; Protein T4-A; Squamous cell carcinoma antigen 1; SCCA-1; SERPINB3 recombinant protein
Host
E Coli
Purity/Purification
>=90%
Form/Format
Liquid containing glycerol
Sequence Positions
2-383
Sequence
NSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILF
Sequence Length
383
Species
Homo sapiens (Human)
Tag
GST-tag
Product Note
Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Product Categories/Family for SERPINB3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,550 Da
NCBI Official Full Name
serpin B3
NCBI Official Synonym Full Names
serpin peptidase inhibitor, clade B (ovalbumin), member 3
NCBI Official Symbol
SERPINB3
NCBI Official Synonym Symbols
SCC; T4-A; SCCA1; SCCA-1; HsT1196; SCCA-PD
NCBI Protein Information
serpin B3; protein T4-A; squamous cell carcinoma antigen 1; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3
UniProt Protein Name
Serpin B3
Protein Family
UniProt Gene Name
SERPINB3
UniProt Synonym Gene Names
SCCA; SCCA1; SCCA-1
UniProt Entry Name
SPB3_HUMAN
Uniprot Description
SERPINB3: May act as a protease inhibitor to modulate the host immune response against tumor cells. Belongs to the serpin family. Ov-serpin subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 18q21.3
Cellular Component: extracellular space; cytoplasm; cytoplasmic vesicle; nucleus; vesicle
Molecular Function: viral receptor activity; serine-type endopeptidase inhibitor activity; protease binding; cysteine protease inhibitor activity
Biological Process: negative regulation of proteolysis; negative regulation of JNK activity; entry of virus into host cell; negative regulation of catalytic activity; positive regulation of cell proliferation; negative regulation of peptidase activity; positive regulation of cell migration
Research Articles on SERPINB3
Similar Products
Product Notes
The SERPINB3 serpinb3 (Catalog #AAA962164) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-383. The amino acid sequence is listed below: NSLSEANTKF MFDLFQQFRK SKENNIFYSP ISITSALGMV LLGAKDNTAQ QIKKVLHFDQ VTENTTGKAA TYHVDRSGNV HHQFQKLLTE FNKSTDAYEL KIANKLFGEK TYLFLQEYLD AIKKFYQTSV ESVDFANAPE ESRKKINSWV ESQTNEKIKN LIPEGNIGSN TTLVLVNAIY FKGQWEKKFN KEDTKEEKFW PNKNTYKSIQ MMRQYTSFHF ASLEDVQAKV LEIPYKGKDL SMIVLLPNEI DGLQKLEEKL TAEKLMEWTS LQNMRETRVD LHLPRFKVEE SYDLKDTLRT MGMVDIFNGD ADLSGMTGSR GLVLSGVLHK AFVEVTEEGA EAAAATAVVG FGSSPTSTNE EFHCNHPFLF FIRQNKTNSI LF . It is sometimes possible for the material contained within the vial of "Serpin B3 (SERPINB3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
