Telomerase protein component 1 Recombinant Protein | TEP1 recombinant protein

Recombinant Human Telomerase protein component 1

Cat. Num. AAA1265371

• Gene Names: TEP1; TP1; TLP1; p240; TROVE1; VAULT2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Telomerase protein component 1; Recombinant Human Telomerase protein component 1; Telomerase-associated protein 1; Telomerase protein 1; p240; p80 telomerase homolog; TEP1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-226aa; Partial
• Sequence: EKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKTMEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKSTVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISATETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLT
• Sequence Length: 2627

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TEP1 recombinant protein

Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC.

Product Categories/Family for TEP1 recombinant protein

Epigenetics and Nuclear Signaling

References

A mammalian telomerase-associated protein.Harrington L., McPhail T., Mar V., Zhou W., Oulton R., Bass M.B., Arruda I., Robinson M.O.Science 275:973-977(1997) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) Human telomerase contains evolutionarily conserved catalytic and structural subunits.Harrington L., Zhou W., McPhail T., Oulton R., Yeung D.S., Mar V., Bass M.B., Robinson M.O.Genes Dev. 11:3109-3115(1997) Vaults and telomerase share a common subunit, TEP1.Kickhoefer V.A., Stephen A.G., Harrington L., Robinson M.O., Rome L.H.J. Biol. Chem. 274:32712-32717(1999) Polymerization defects within human telomerase are distinct from telomerase RNA and TEP1 binding.Beattie T.L., Zhou W., Robinson M.O., Harrington L.Mol. Biol. Cell 11:3329-3340(2000) A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis.Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E.Science 323:644-648(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 21536371
• NCBI GeneID: 7011
• NCBI Accession #: NP_009041.2
• NCBI GenBank Nucleotide #: NM_007110.4
• UniProt Accession #: Q99973; A0AUV9
• Molecular Weight: 28.8 kDa
• NCBI Official Full Name: telomerase protein component 1 isoform 1
• NCBI Official Synonym Full Names: telomerase associated protein 1
• NCBI Official Symbol: TEP1
• NCBI Official Synonym Symbols: TP1; TLP1; p240; TROVE1; VAULT2
• NCBI Protein Information: telomerase protein component 1
• UniProt Protein Name: Telomerase protein component 1
• Protein Family: Telomerase protein component
• UniProt Gene Name: TEP1
• UniProt Synonym Gene Names: TLP1; TP1; Telomerase protein 1
• UniProt Entry Name: TEP1_HUMAN

NCBI Description

This gene product is a component of the ribonucleoprotein complex responsible for telomerase activity which catalyzes the addition of new telomeres on the chromosome ends. The telomerase-associated proteins are conserved from ciliates to humans. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

TEP1: Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi- subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: chromosome, telomeric region; cytoplasm; nuclear matrix; ribonucleoprotein complex; telomerase holoenzyme complex

Molecular Function: ATP binding; enzyme binding; p53 binding; RNA binding; telomerase activity

Biological Process: RNA-dependent DNA replication; telomere maintenance via recombination