Serine protease inhibitor A3N Recombinant Protein | Serpina3n recombinant protein

Recombinant Mouse Serine protease inhibitor A3N

Cat. Num. AAA1463118

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Serine protease inhibitor A3N; Recombinant Mouse Serine protease inhibitor A3N; Serpina3n recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-418. Full Length of Mature Protein
• Sequence: FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK (The mutant sequence with 21-21: F SF and 315-315: S missing is available as Cat. # MBS7110959)

• Production Note: Special Offer: The E Coli, Mammalian-Cell, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Mammalian-Cell, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Mammalian-Cell, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Mammalian-Cell, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

References

Isolation of two cDNAs encoding novel alpha-1-antichymotrypsin-like proteins in a murine chondrocytic cell line.Inglis J.D., Lee M., Davidson D.R., Hill R.E.Gene 106:213-220(1991) A review and comparison of the murine alpha1-antitrypsin and alpha1-antichymotrypsin multigene clusters with the human clade A serpins.Forsyth S., Horvath A., Coughlin P.Genomics 81:336-345(2003) Expression patterns of murine antichymotrypsin-like genes reflect evolutionary divergence at the Serpina3 locus.Horvath A.J., Forsyth S.L., Coughlin P.B.J. Mol. Evol. 59:488-497(2004) The murine orthologue of human antichymotrypsin a structural paradigm for clade A3 serpins.Horvath A.J., Irving J.A., Rossjohn J., Law R.H., Bottomley S.P., Quinsey N.S., Pike R.N., Coughlin P.B., Whisstock J.C.J. Biol. Chem. 280:43168-43178(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 68053311
• UniProt Accession #: Q91WP6; Q62258
• Molecular Weight: 46.8 kDa
• NCBI Official Full Name: Serine protease inhibitor A3N
• UniProt Protein Name: Serine protease inhibitor A3N
• Protein Family: Serine protease inhibitor
• UniProt Gene Name: Serpina3n
• UniProt Synonym Gene Names: Spi2; Serpin A3N
• UniProt Entry Name: SPA3N_MOUSE

Uniprot Description

SERPINA3: Although its physiological function is unclear, it can inhibit neutrophil cathepsin G and mast cell chymase, both of which can convert angiotensin-1 to the active angiotensin-2. Belongs to the serpin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: extracellular region; extracellular space

Molecular Function: protease inhibitor activity; serine-type endopeptidase inhibitor activity

Biological Process: acute-phase response; negative regulation of peptidase activity; response to cytokine stimulus; response to peptide hormone stimulus