Sentrin-specific protease 8 Recombinant Protein | SENP8 recombinant protein

Recombinant Human Sentrin-specific protease 8

Cat. Num. AAA1307410

• Gene Names: SENP8; DEN1; NEDP1; PRSC2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sentrin-specific protease 8; Recombinant Human Sentrin-specific protease 8; Deneddylase-1; NEDD8-specific protease 1; Protease; cysteine 2; Sentrin/SUMO-specific protease SENP8; SENP8 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-212aa; Full Length
• Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
• Sequence Length: 212

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SENP8 recombinant protein

Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.

Product Categories/Family for SENP8 recombinant protein

Epigenetics and Nuclear Signaling

References

NEDP1, a highly conserved cysteine protease that deneddylates cullins.Mendoza H.M., Shen L.-N., Botting C., Lewis A., Chen J., Ink B., Hay R.T.J. Biol. Chem. 278:25637-25643(2003) Identification of SENP8, a novel member of the sentrin-specific protease family.Gong L., Yeh E.T.H. Identification of FKSG8, a novel gene encoding a protein with cysteine protease activity.Wang Y.-G. DEN1 is a dual function protease capable of processing the C-terminus of Nedd8 and deconjugating hyper-neddylated CUL1.Wu K., Yamoah K., Dolios G., Gan-Erdene T., Tan P., Chen A., Lee C.-G., Wei N., Wilkinson K.D., Wang R., Pan Z.-Q.J. Biol. Chem. 278:28882-28891(2003) Identification and characterization of DEN1, a deneddylase of the ULP family.Gan-Erdene T., Nagamalleswari K., Yin L., Wu K., Pan Z.-Q., Wilkinson K.D.J. Biol. Chem. 278:28892-28900(2003) Mdm2-mediated NEDD8 conjugation of p53 inhibits its transcriptional activity.Xirodimas D.P., Saville M.K., Bourdon J.-C., Hay R.T., Lane D.P.Cell 118:83-97(2004) Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009) Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) Structural basis of NEDD8 ubiquitin discrimination by the deneddylating enzyme NEDP1.Shen L.-N., Liu H., Dong C., Xirodimas D.P., Naismith J.H., Hay R.T.EMBO J. 24:1341-1351(2005) Structure of a complex between Nedd8 and the Ulp/Senp protease family member Den1.Reverter D., Wu K., Erdene T.G., Pan Z.-Q., Wilkinson K.D., Lima C.D.J. Mol. Biol. 345:141-151(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 262118308
• NCBI GeneID: 123228
• NCBI Accession #: NP_001159812.1
• NCBI GenBank Nucleotide #: NM_001166340.1
• UniProt Accession #: Q96LD8; Q96QA4
• Molecular Weight: 40.1 kDa
• NCBI Official Full Name: sentrin-specific protease 8
• NCBI Official Synonym Full Names: SUMO/sentrin peptidase family member, NEDD8 specific
• NCBI Official Symbol: SENP8
• NCBI Official Synonym Symbols: DEN1; NEDP1; PRSC2
• NCBI Protein Information: sentrin-specific protease 8
• UniProt Protein Name: Sentrin-specific protease 8
• Protein Family: Sentrin-specific protease
• UniProt Gene Name: SENP8
• UniProt Synonym Gene Names: DEN1; NEDP1; PRSC2
• UniProt Entry Name: SENP8_HUMAN

NCBI Description

This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]

Uniprot Description

SENP8: Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53. Belongs to the peptidase C48 family.

Protein type: Protease; EC 3.4.22.68

Chromosomal Location of Human Ortholog: 15q23

Molecular Function: cysteine-type peptidase activity

Biological Process: proteolysis