Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SNX9 expression in transfected 293T cell line by SNX9 polyclonal antibody. Lane 1: SNX9 transfected lysate (66.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SNX9 Polyclonal Antibody | anti-SNX9 antibody

SNX9 (Sorting Nexin-9, SH3 and PX Domain-containing Protein 1, Protein SDP1, SH3PX1, SH3 and PX Domain-containing Protein 3A, SH3PXD3A) (AP)

Gene Names
SNX9; SDP1; WISP; SH3PX1; SH3PXD3A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNX9; Polyclonal Antibody; SNX9 (Sorting Nexin-9; SH3 and PX Domain-containing Protein 1; Protein SDP1; SH3PX1; SH3 and PX Domain-containing Protein 3A; SH3PXD3A) (AP); MST155; MSTP155; WISP; anti-SNX9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SNX9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SNX9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SNX9, aa1-595 (NP_057308.1).
Immunogen Sequence
MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SNX9 expression in transfected 293T cell line by SNX9 polyclonal antibody. Lane 1: SNX9 transfected lysate (66.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SNX9 expression in transfected 293T cell line by SNX9 polyclonal antibody. Lane 1: SNX9 transfected lysate (66.6kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SNX9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,592 Da
NCBI Official Full Name
sorting nexin-9
NCBI Official Synonym Full Names
sorting nexin 9
NCBI Official Symbol
SNX9
NCBI Official Synonym Symbols
SDP1; WISP; SH3PX1; SH3PXD3A
NCBI Protein Information
sorting nexin-9
UniProt Protein Name
Sorting nexin-9
Protein Family
UniProt Gene Name
SNX9
UniProt Synonym Gene Names
SH3PX1; SH3PXD3A; Protein SDP1
UniProt Entry Name
SNX9_HUMAN

NCBI Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phosphoinositide binding domain, and are involved in intracellular trafficking. The encoded protein does not contain a coiled coil region, like some family members, but does contain a SRC homology domain near its N-terminus. The encoded protein is reported to have a variety of interaction partners, including of adaptor protein 2 , dynamin, tyrosine kinase non-receptor 2, Wiskott-Aldrich syndrome-like, and ARP3 actin-related protein 3. The encoded protein is implicated in several stages of intracellular trafficking, including endocytosis, macropinocytosis, and F-actin nucleation. [provided by RefSeq, Jul 2013]

Uniprot Description

SNX9: May be involved in several stages of intracellular trafficking. Plays a role in endocytosis via clathrin-coated pits, but also clathrin-independent, actin-dependent fluid-phase endocytosis. Plays a role in macropinocytosis. Promotes internalization of TNFR. Promotes degradation of EGFR after EGF signaling. Stimulates the GTPase activity of DNM1. Promotes DNM1 oligomerization. Promotes activation of the Arp2/3 complex by WASL, and thereby plays a role in the reorganization of the F- actin cytoskeleton. Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate and promotes membrane tubulation. Has lower affinity for membranes enriched in phosphatidylinositol 3-phosphate. Belongs to the sorting nexin family.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 6q25.3

Cellular Component: ruffle; extrinsic to internal side of plasma membrane; cytoplasmic vesicle membrane; clathrin-coated vesicle; cytoplasmic membrane-bound vesicle; cytoplasm; plasma membrane; trans-Golgi network; endosome

Molecular Function: protein binding; protein homodimerization activity; ubiquitin protein ligase binding; phosphoinositide binding; phosphatidylinositol binding

Biological Process: mitosis; intracellular protein transport; receptor-mediated endocytosis; positive regulation of protein oligomerization; cytokinesis after mitosis; positive regulation of protein kinase activity; vesicle organization and biogenesis; endocytosis; endosome transport; positive regulation of membrane protein ectodomain proteolysis; positive regulation of GTPase activity

Research Articles on SNX9

Similar Products

Product Notes

The SNX9 snx9 (Catalog #AAA6394729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNX9 (Sorting Nexin-9, SH3 and PX Domain-containing Protein 1, Protein SDP1, SH3PX1, SH3 and PX Domain-containing Protein 3A, SH3PXD3A) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNX9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNX9 snx9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNX9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.