Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Selenoprotein T Recombinant Protein | Selt recombinant protein

Recombinant Mouse Selenoprotein T

Gene Names
Selt; 2810407C02Rik; 5730408P04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Selenoprotein T; Recombinant Mouse Selenoprotein T; Selt recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-195aa; Full Length
Sequence
SANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS
Sequence Length
195
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.2 kDa
NCBI Official Full Name
selenoprotein T
NCBI Official Synonym Full Names
selenoprotein T
NCBI Official Symbol
Selt
NCBI Official Synonym Symbols
2810407C02Rik; 5730408P04Rik
NCBI Protein Information
selenoprotein T
UniProt Protein Name
Selenoprotein T
Protein Family
UniProt Gene Name
Selt
UniProt Synonym Gene Names
SelT
UniProt Entry Name
SELT_MOUSE

NCBI Description

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jul 2008]

Uniprot Description

SELT: a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jul 2008]

Protein type: Secreted, signal peptide; Secreted

Cellular Component: endoplasmic reticulum

Biological Process: glucose homeostasis; pancreas development; response to glucose stimulus

Research Articles on Selt

Similar Products

Product Notes

The Selt selt (Catalog #AAA1046912) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-195aa; Full Length. The amino acid sequence is listed below: SANLGGVPSK RLKMQYATGP LLKFQICVSU GYRRVFEEYM RVISQRYPDI RIEGENYLPQ PIYRHIASFL SVFKLVLIGL IIVGKDPFAF FGMQAPSIWQ WGQENKVYAC MMVFFLSNMI ENQCMSTGAF EITLNDVPVW SKLESGHLPS MQQLVQILDN EMKLNVHMDS IPHHRS. It is sometimes possible for the material contained within the vial of "Selenoprotein T, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.