Protein SEC13 homolog (Sec13) Recombinant Protein | Sec13 recombinant protein
Recombinant Rat Protein SEC13 homolog (Sec13)
Gene Names
Sec13; Sec13l1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein SEC13 homolog (Sec13); Recombinant Rat Protein SEC13 homolog (Sec13); Sec13 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-322, full length protein
Sequence
VSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWREEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASITEGQQNEQ
Sequence Length
321
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Sec13 recombinant protein
This protein belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,548 Da
NCBI Official Full Name
protein SEC13 homolog
NCBI Official Synonym Full Names
SEC13 homolog, nuclear pore and COPII coat complex component
NCBI Official Symbol
Sec13
NCBI Official Synonym Symbols
Sec13l1
NCBI Protein Information
protein SEC13 homolog
UniProt Protein Name
Protein SEC13 homolog
Protein Family
UniProt Gene Name
Sec13
UniProt Synonym Gene Names
Sec13l1
Uniprot Description
Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.
Similar Products
Product Notes
The Sec13 sec13 (Catalog #AAA1403695) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-322, full length protein. The amino acid sequence is listed below: VSVINTVDTS HEDMIHDAQM DYYGTRLATC SSDRSVKIFD VRNGGQILIA DLRGHEGPVW QVAWAHPMYG NILASCSYDR KVIIWKEENG TWEKTHEHSG HDSSVNSVCW APHDYGLILA CGSSDGAISL LTYTGEGQWE VKKINNAHTI GCNAVSWAPA VVPGSLIDQP SGQKPNYIKK FASGGCDNLI KLWREEEDGQ WKEEQKLEAH SDWVRDVAWA PSIGLPTSTI ASCSQDGRVF IWTCDDASGN MWSPKLLHKF NDVVWHVSWS ITANILAVSG GDNKVTLWKE SVDGQWVCIS DVNKGQGSVS ASITEGQQNE Q. It is sometimes possible for the material contained within the vial of "Protein SEC13 homolog (Sec13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
