Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC) Recombinant Protein | SDHC recombinant protein
Recombinant Bovine Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Succinate dehydrogenase cytochrome b560 subunit; mitochondrial (SDHC); Recombinant Bovine Succinate dehydrogenase cytochrome b560 subunit; Recombinant Succinate dehydrogenase cytochrome b560 subunit; mitochondrial; Integral membrane protein CII-3 QPs-1; QPs1 Succinate dehydrogenase complex subunit C; SDHC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-169
Sequence
LGTTAKEEMERFWSKNTTLNRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSALLVPGSFESHLEFVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLTISQLHQSGVAVLVLTVLSSVGLAAM
Sequence Length
169
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18,389 Da
NCBI Official Full Name
succinate dehydrogenase cytochrome b560 subunit, mitochondrial
NCBI Official Synonym Full Names
succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
NCBI Official Symbol
SDHC
NCBI Protein Information
succinate dehydrogenase cytochrome b560 subunit, mitochondrial; QPs1; QPs-1; integral membrane protein CII-3; succinate dehydrogenase complex subunit C
UniProt Protein Name
Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
Protein Family
UniProt Gene Name
SDHC
UniProt Synonym Gene Names
CYB560; QPs1
UniProt Entry Name
C560_BOVIN
Uniprot Description
Function: Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Cofactor: Heme group. The heme is bound between the two transmembrane subunits SDHC and SDHD
By similarity.
Pathway: Carbohydrate metabolism; tricarboxylic acid cycle.
Subunit structure: Component of complex II composed of four subunits: the flavoprotein (FP) SDHA, iron-sulfur protein (IP) SDHB, and a cytochrome b560 composed of SDHC and SDHD.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein.
Post-translational modification: The N-terminus is blocked.
Sequence similarities: Belongs to the cytochrome b560 family.
Research Articles on SDHC
Similar Products
Product Notes
The SDHC sdhc (Catalog #AAA954845) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-169. The amino acid sequence is listed below: LGTTAKEEME RFWSKNTTLN RPLSPHISIY GWSLPMAMSI CHRGTGIALS AGVSLFGLSA LLVPGSFESH LEFVKSLCLG PALIHTAKFA LVFPLMYHTW NGIRHLMWDL GKGLTISQLH QSGVAVLVLT VLSSVGLAAM. It is sometimes possible for the material contained within the vial of "Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
