SDS-PAGE
Scrapie-responsive protein 1 (Scrg1) Recombinant Protein | Scrg1 recombinant protein
Recombinant Mouse Scrapie-responsive protein 1 (Scrg1)
Gene Names
Scrg1; AW124307
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Scrapie-responsive protein 1 (Scrg1); Recombinant Mouse Scrapie-responsive protein 1 (Scrg1); Scrapie-responsive gene 1 protein; ScRG-1; Scrg1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-98. Full Length of Mature Protein
Sequence
MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
References
SCRG1 suppresses LPS-induced CCL22 production through ERK1/2 activation in mouse macrophage Raw264.7 cells. Manabu Inoue, Junko Yamada, Emiko Aomatsu-Kikuchi, Kazuro Satoh, Hisatomo Kondo, Akira Ishisaki, Naoyuki Chosa (2017)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11 kDa
NCBI Official Full Name
scrapie-responsive protein 1
NCBI Official Synonym Full Names
scrapie responsive gene 1
NCBI Official Symbol
Scrg1
NCBI Official Synonym Symbols
AW124307
NCBI Protein Information
scrapie-responsive protein 1
UniProt Protein Name
Scrapie-responsive protein 1
Protein Family
UniProt Gene Name
Scrg1
UniProt Synonym Gene Names
ScRG-1
UniProt Entry Name
SCRG1_MOUSE
Uniprot Description
SCRG1: Scrapie-responsive gene 1 is associated with neurodegenerative changes observed in transmissible spongiform encephalopathies. It may play a role in host response to prion-associated infections. The scrapie responsive protein 1 may be partly included in the membrane or secreted by the cells due to its hydrophobic N-terminus. [provided by RefSeq, Jul 2008]
Protein type: Secreted, signal peptide; Secreted
Cellular Component: cytoplasm; extracellular region; Golgi apparatus
Research Articles on Scrg1
Similar Products
Product Notes
The Scrg1 scrg1 (Catalog #AAA1177239) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-98. Full Length of Mature Protein. The amino acid sequence is listed below: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. It is sometimes possible for the material contained within the vial of "Scrapie-responsive protein 1 (Scrg1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
