Protein S100-B (S100b) Recombinant Protein | S100b recombinant protein

Recombinant Mouse Protein S100-B (S100b)

Cat. Num. AAA717679

• Gene Names: S100b; Bpb; AI850290
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein S100-B (S100b); Recombinant Mouse Protein S100-B (S100b); S100b recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-92, Full length protein
• Sequence: SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE
• Sequence Length: 91

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for S100b recombinant protein

This protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and
or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer s disease, Down s syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes.

NCBI and Uniprot Product Information

• NCBI GI #: 6677839
• NCBI GeneID: 20203
• NCBI Accession #: NP_033141.1
• NCBI GenBank Nucleotide #: NM_009115.3
• UniProt Accession #: P50114
• Molecular Weight: 10,728 Da
• NCBI Official Full Name: protein S100-B
• NCBI Official Synonym Full Names: S100 protein, beta polypeptide, neural
• NCBI Official Symbol: S100b
• NCBI Official Synonym Symbols: Bpb; AI850290
• NCBI Protein Information: protein S100-B
• UniProt Protein Name: Protein S100-B
• Protein Family: Protein
• UniProt Gene Name: S100b

Uniprot Description

Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity ().