S100-A4 Recombinant Protein | S100A4 recombinant protein

Recombinant Human Protein S100-A4

Cat. Num. AAA718530

• Gene Names: S100A4; 42A; 18A2; CAPL; FSP1; MTS1; P9KA; PEL98
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: S100-A4; Recombinant Human Protein S100-A4; Calvasculin; Metastasin; Placental calcium-binding protein; Protein Mts1; S100 calcium-binding protein A4; S100A4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-101aa; Full Length of Mature Protein
• Sequence: ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
• Sequence Length: 101

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Product Categories/Family for S100A4 recombinant protein

Cardiovascular

References

S100 alpha, CAPL, and CACY molecular cloning and expression analysis of three calcium-binding proteins from human heart.Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W.Biochemistry 31:10258-10264(1992) Six S100 genes are clustered on human chromosome 1q21 identification of two genes coding for the two previously unreported calcium-binding proteins S100D and S100E.Engelkamp D., Schaefer B.W., Mattei M.-G., Erne P., Heizmann C.W.Proc. Natl. Acad. Sci. U.S.A. 90:6547-6551(1993) Transcriptional analysis of the mts1 gene with specific reference to 5' flanking sequences.Tulchinsky E.M., Ford H.L., Kramerov D., Reshetnyak E., Grigorian M., Zain S., Lukanidin E.Proc. Natl. Acad. Sci. U.S.A. 89:9146-9150(1992)

NCBI and Uniprot Product Information

• NCBI GI #: 4506765
• NCBI GeneID: 6275
• NCBI Accession #: NP_002952.1
• NCBI GenBank Nucleotide #: NM_002961.2
• UniProt Accession #: P26447; Q6ICP8; A8K7R8; D3DV46
• Molecular Weight: 27.6 kDa
• NCBI Official Full Name: protein S100-A4
• NCBI Official Synonym Full Names: S100 calcium binding protein A4
• NCBI Official Symbol: S100A4
• NCBI Official Synonym Symbols: 42A; 18A2; CAPL; FSP1; MTS1; P9KA; PEL98
• NCBI Protein Information: protein S100-A4
• UniProt Protein Name: Protein S100-A4
• Protein Family: Protein
• UniProt Gene Name: S100A4
• UniProt Synonym Gene Names: CAPL; MTS1
• UniProt Entry Name: S10A4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

S100A4: is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extracellular space; neuron projection; nucleus; perinuclear region of cytoplasm

Molecular Function: actin binding; calcium ion binding; calcium-dependent protein binding; identical protein binding; protein binding; RAGE receptor binding

Biological Process: epithelial to mesenchymal transition; positive regulation of I-kappaB kinase/NF-kappaB cascade