Relaxin-3 receptor 2 (RXFP4) Recombinant Protein | RXFP4 recombinant protein
Recombinant Human Relaxin-3 receptor 2 (RXFP4)
Gene Names
RXFP4; GPR100; RLN3R2; RXFPR4; GPCR142
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Relaxin-3 receptor 2 (RXFP4); Recombinant Human Relaxin-3 receptor 2 (RXFP4); RXFP4 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-374aa; full length protein
Sequence
MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAV LWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTA TVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFG VEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQD SRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHS NSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESR PSTLLTNLDRGTPG
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RXFP4 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,141 Da
NCBI Official Full Name
relaxin-3 receptor 2
NCBI Official Synonym Full Names
relaxin/insulin like family peptide receptor 4
NCBI Official Symbol
RXFP4
NCBI Official Synonym Symbols
GPR100; RLN3R2; RXFPR4; GPCR142
NCBI Protein Information
relaxin-3 receptor 2
UniProt Protein Name
Relaxin-3 receptor 2
Protein Family
UniProt Gene Name
RXFP4
UniProt Synonym Gene Names
GPR100; RLN3R2; RLN3 receptor 2
UniProt Entry Name
RL3R2_HUMAN
NCBI Description
GPR100 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).[supplied by OMIM, Mar 2008]
Uniprot Description
RXFP4: High affinity receptor for INSL5. Also acts as receptor for RLN3/relaxin-3, as well as bradykinin and kallidin. Binding of the ligand inhibit cAMP accumulation. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1
Chromosomal Location of Human Ortholog: 1q22
Cellular Component: integral to plasma membrane; plasma membrane
Molecular Function: angiotensin type II receptor activity; peptide receptor activity, G-protein coupled; protein binding
Biological Process: G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); neuropeptide signaling pathway
Research Articles on RXFP4
Similar Products
Product Notes
The RXFP4 rxfp4 (Catalog #AAA7029197) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-374aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RXFP4 rxfp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPTLNTSASP PTFFWANASG GSVLSADDAP MPVKFLALRL MVALAYGLVG AIGLLGNLAV LWVLSNCARR APGPPSDTFV FNLALADLGL ALTLPFWAAE SALDFHWPFG GALCKMVLTA TVLNVYASIF LITALSVARY WVVAMAAGPG THLSLFWARI ATLAVWAAAA LVTVPTAVFG VEGEVCGVRL CLLRFPSRYW LGAYQLQRVV LAFMVPLGVI TTSYLLLLAF LQRRQRRRQD SRVVARSVRI LVASFFLCWF PNHVVTLWGV LVKFDLVPWN STFYTIQTYV FPVTTCLAHS NSCLNPVLYC LLRREPRQAL AGTFRDLRLR LWPQGGGWVQ QVALKQVGRR WVASNPRESR PSTLLTNLDR GTPG. It is sometimes possible for the material contained within the vial of "Relaxin-3 receptor 2 (RXFP4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
