SDS-PAGE
30S ribosomal protein S6 Recombinant Protein | rpsF recombinant protein
Recombinant E Coli 30S ribosomal protein S6
Gene Names
rpsF; ECK4196; JW4158; sdgH
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
30S ribosomal protein S6; Recombinant E Coli 30S ribosomal protein S6; rpsF recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-131aa; Partial
Sequence
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE
Sequence Length
131
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for rpsF recombinant protein
Binds together with S18 to 16S ribosomal RNA.
References
Determination of the complete amino-acid sequence of protein S6 from the wild-type and a mutant of Escherichia coli.Hitz H., Schaefer D., Wittmann-Liebold B.Eur. J. Biochem. 75:497-512(1977)
The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame.Schnier J., Kitakawa M., Isono K.Mol. Gen. Genet. 204:126-132(1986)
Analysis of the Escherichia coli genome VI
DNA sequence of the region from 92.8 through 100 minutes.Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995)
The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Small genes/gene-products in Escherichia coli K-12.Wasinger V.C., Humphery-Smith I.FEMS Microbiol. Lett. 169:375-382(1998)
Pasquali C., Sanchez J.-C., Ravier F., Golaz O., Hughes G.J., Frutiger S., Paquet N., Wilkins M., Appel R.D., Bairoch A., Hochstrasser D.F.Submitted (SEP-1994)
to UniProtKB
Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997)
Protein identification with N and C-terminal sequence tags in proteome projects.Wilkins M.R., Gasteiger E., Tonella L., Ou K., Tyler M., Sanchez J.-C., Gooley A.A., Walsh B.J., Bairoch A., Appel R.D., Williams K.L., Hochstrasser D.F.J. Mol. Biol. 278:599-608(1998)
Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997)
Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999)
Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli.Zhang J., Sprung R., Pei J., Tan X., Kim S., Zhu H., Liu C.F., Grishin N.V., Zhao Y.Mol. Cell. Proteomics 8:215-225(2009)
All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002)
Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003)
Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42.2 kDa
NCBI Official Full Name
30S ribosomal subunit protein S6
NCBI Official Symbol
rpsF
NCBI Official Synonym Symbols
ECK4196; JW4158; sdgH
NCBI Protein Information
30S ribosomal subunit protein S6
UniProt Protein Name
30S ribosomal protein S6
Protein Family
UniProt Gene Name
rpsF
UniProt Entry Name
RS6_ECOLI
NCBI Description
RpsF is modified posttranslationally by RimK, which adds four glutamic acid residues to the RpsF C-terminus. [More information is available at EcoGene: EG10905]. The S6 protein is a component of the 30S subunit of the ribosome. [More information is available at EcoCyc: EG10905].
Uniprot Description
Binds together with S18 to 16S ribosomal RNA.
Research Articles on rpsF
Similar Products
Product Notes
The rpsF rpsf (Catalog #AAA1265205) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-131aa; Partial. The amino acid sequence is listed below: MRHYEIVFMV HPDQSEQVPG MIERYTAAIT GAEGKIHRLE DWGRRQLAYP INKLHKAHYV LMNVEAPQEV IDELETTFRF NDAVIRSMVM RTKHAVTEAS PMVKAKDERR ERRDDFANET ADDAEAGDSE E. It is sometimes possible for the material contained within the vial of "30S ribosomal protein S6, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
