SDS-PAGE
Alba-like protein C9orf23 (C9orf23) Recombinant Protein | C9orf23 recombinant protein
Recombinant Human Alba-like protein C9orf23 (C9orf23)
Gene Names
RPP25L; C9orf23; bA296L22.5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alba-like protein C9orf23 (C9orf23); Recombinant Human Alba-like protein C9orf23 (C9orf23); Alba-like protein C9orf23; C9orf23 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-163aa; Full Length
Sequence
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Sequence Length
163
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for C9orf23 recombinant protein
May be a component of ribonuclease P or MRP.
Product Categories/Family for C9orf23 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44.6 kDa
NCBI Official Full Name
ribonuclease P protein subunit p25-like protein
NCBI Official Synonym Full Names
ribonuclease P/MRP 25kDa subunit-like
NCBI Official Symbol
RPP25L
NCBI Official Synonym Symbols
C9orf23; bA296L22.5
NCBI Protein Information
ribonuclease P protein subunit p25-like protein; rpp25-like protein; alba-like protein C9orf23; RNase P protein subunit-like p25
UniProt Protein Name
Ribonuclease P protein subunit p25-like protein
UniProt Gene Name
RPP25L
UniProt Synonym Gene Names
C9orf23; RNase P protein subunit-like p25
UniProt Entry Name
RP25L_HUMAN
NCBI Description
This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Uniprot Description
RPP25L: May be a component of ribonuclease P or MRP. Belongs to the histone-like Alba family.
Chromosomal Location of Human Ortholog: 9p13.3
Cellular Component: nucleus
Similar Products
Product Notes
The C9orf23 rpp25l (Catalog #AAA1487530) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-163aa; Full Length. The amino acid sequence is listed below: MEHYRKAGSV ELPAPSPMPQ LPPDTLEMRV RDGSKIRNLL GLALGRLEGG SARHVVFSGS GRAAGKAVSC AEIVKRRVPG LHQLTKLRFL QTEDSWVPAS PDTGLDPLTV RRHVPAVWVL LSRDPLDPNE CGYQPPGAPP GLGSMPSSSC GPRSRRRARD TRS. It is sometimes possible for the material contained within the vial of "Alba-like protein C9orf23 (C9orf23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
