60S ribosomal protein L13a (Rpl13a) Recombinant Protein | Rpl13a recombinant protein

Recombinant Mouse 60S ribosomal protein L13a (Rpl13a)

Cat. Num. AAA718747

• Gene Names: Rpl13a; Tstap198-7; tum-antigen; 1810026N22Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 60S ribosomal protein L13a (Rpl13a); Recombinant Mouse 60S ribosomal protein L13a (Rpl13a); Rpl13a recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-203, Full length protein
• Sequence: AEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTNGLLV
• Sequence Length: 202

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Rpl13a recombinant protein

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative polyA signals have been observed. This gene is co-transcribed with the small nucleolar RNA genes U32, U33, U34, and U35, which are located in its second, fourth, fifth, and sixth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

NCBI and Uniprot Product Information

• NCBI GI #: 31981945
• NCBI GeneID: 22121
• NCBI Accession #: NP_033464.2
• NCBI GenBank Nucleotide #: NM_009438.5
• UniProt Accession #: P19253
• Molecular Weight: 23,464 Da
• NCBI Official Full Name: 60S ribosomal protein L13a
• NCBI Official Synonym Full Names: ribosomal protein L13A
• NCBI Official Symbol: Rpl13a
• NCBI Official Synonym Symbols: Tstap198-7; tum-antigen; 1810026N22Rik
• NCBI Protein Information: 60S ribosomal protein L13a
• UniProt Protein Name: 60S ribosomal protein L13a
• Protein Family: 60S ribosomal protein
• UniProt Gene Name: Rpl13a
• UniProt Synonym Gene Names: P198; Tstap198-7

Uniprot Description

Associated with ribosomes but is not required for canonical ribosome function and has extra-ribosomal functions (). Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma activation and subsequent phosphorylation dissociates from the ribosome and assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation. In the GAIT complex interacts with m7G cap-bound eIF4G at or near the eIF3-binding site and blocks the recruitment of the 43S ribosomal complex.