Protein ROT1 (ROT1) Recombinant Protein | LELG_01357 recombinant protein
Recombinant Lodderomyces elongisporus Protein ROT1 (ROT1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein ROT1 (ROT1); Recombinant Lodderomyces elongisporus Protein ROT1 (ROT1); Recombinant Protein ROT1 (ROT1); Protein ROT1; LELG_01357 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-256
Sequence
DPLMEELEGTWTSKSNTVFTGPGFYDPVEELLIEPDLPGISYSFTKDGHYEEALYRVVSNPKNHSCPVASVTYQHGTYEIASNGSVMLTPIAVDGRQLLSDPCNQDDPNVSTYSRYVQSTYFKTYQKYVDPYHGRWTLQIYQFDGSKMQPLYLAYKPPLMLPTYALNPTDAASETDSELNDDDSSKSNSKSRRSRIKRSLENQYRTNAIRQTHDESMDKYWWFSVACLGLGSAYMFLK
Sequence Length
256
Species
Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,188 Da
NCBI Official Full Name
conserved hypothetical protein
NCBI Official Symbol
LELG_01357
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Protein ROT1
UniProt Gene Name
ROT1
UniProt Entry Name
ROT1_LODEL
Uniprot Description
Function: Required for normal levels of the cell wall 1,6-beta-glucan. Involved in a protein folding machinery chaperoning proteins acting in various physiological processes including cell wall synthesis and lysis of autophagic bodies
By similarity.
Subcellular location: Endoplasmic reticulum membrane; Single-pass type I membrane protein
By similarity.
Sequence similarities: Belongs to the ROT1 family.
Similar Products
Product Notes
The LELG_01357 rot1 (Catalog #AAA1077546) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-256. The amino acid sequence is listed below: DPLMEELEGT WTSKSNTVFT GPGFYDPVEE LLIEPDLPGI SYSFTKDGHY EEALYRVVSN PKNHSCPVAS VTYQHGTYEI ASNGSVMLTP IAVDGRQLLS DPCNQDDPNV STYSRYVQST YFKTYQKYVD PYHGRWTLQI YQFDGSKMQP LYLAYKPPLM LPTYALNPTD AASETDSELN DDDSSKSNSK SRRSRIKRSL ENQYRTNAIR QTHDESMDKY WWFSVACLGL GSAYMFLK. It is sometimes possible for the material contained within the vial of "Protein ROT1 (ROT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
