RING finger and transmembrane domain-containing protein 1 (RNFT1) Recombinant Protein | RNFT1 recombinant protein
Recombinant Human RING finger and transmembrane domain-containing protein 1 (RNFT1)
Gene Names
RNFT1; PTD016
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RING finger and transmembrane domain-containing protein 1 (RNFT1); Recombinant Human RING finger and transmembrane domain-containing protein 1 (RNFT1); RNFT1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-435aa; full length protein
Sequence
MPLFLLSLPTPPSASGHERRQRPEAKTSGSEKKYLRAMQANRSQLHSPPGTGSSEDASTP QCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSH SEARLTDDTAAESGDHGSSSFSEFRYLFKWLQKSLPYILILSVKLVMQHITGISLGIGLL TTFMYANKSIVNQVFLRERSSKIQCAWLLVFLAGSSVLLYYTFHSQSLYYSLIFLNPTLD HLSFWEVFWIVGITDFILKFFFMGLKCLILLVPSFIMPFKSKGYWYMLLEELCQYYRTFV PIPVWFRYLISYGEFGNVTRWSLGILLALLYLILKLLEFFGHLRTFRQVLRIFFTQPSYG VAASKRQCSDVDDICSICQAEFQKPILLICQHIFCEECMTLWFNREKTCPLCRTVISDHI NKWKDGATSSHLQIY
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RNFT1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,302 Da
NCBI Official Full Name
RING finger and transmembrane domain-containing protein 1
NCBI Official Synonym Full Names
ring finger protein, transmembrane 1
NCBI Official Symbol
RNFT1
NCBI Official Synonym Symbols
PTD016
NCBI Protein Information
RING finger and transmembrane domain-containing protein 1
UniProt Protein Name
RING finger and transmembrane domain-containing protein 1
Protein Family
UniProt Gene Name
RNFT1
UniProt Entry Name
RNFT1_HUMAN
Uniprot Description
RNFT1: 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Ubiquitin conjugating system; Membrane protein, integral
Chromosomal Location of Human Ortholog: 17q23.1
Cellular Component: integral to membrane
Molecular Function: zinc ion binding
Research Articles on RNFT1
Similar Products
Product Notes
The RNFT1 rnft1 (Catalog #AAA7029055) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-435aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RNFT1 rnft1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPLFLLSLPT PPSASGHERR QRPEAKTSGS EKKYLRAMQA NRSQLHSPPG TGSSEDASTP QCVHTRLTGE GSCPHSGDVH IQINSIPKEC AENASSRNIR SGVHSCAHGC VHSRLRGHSH SEARLTDDTA AESGDHGSSS FSEFRYLFKW LQKSLPYILI LSVKLVMQHI TGISLGIGLL TTFMYANKSI VNQVFLRERS SKIQCAWLLV FLAGSSVLLY YTFHSQSLYY SLIFLNPTLD HLSFWEVFWI VGITDFILKF FFMGLKCLIL LVPSFIMPFK SKGYWYMLLE ELCQYYRTFV PIPVWFRYLI SYGEFGNVTR WSLGILLALL YLILKLLEFF GHLRTFRQVL RIFFTQPSYG VAASKRQCSD VDDICSICQA EFQKPILLIC QHIFCEECMT LWFNREKTCP LCRTVISDHI NKWKDGATSS HLQIY. It is sometimes possible for the material contained within the vial of "RING finger and transmembrane domain-containing protein 1 (RNFT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
