Electron transport complex protein RnfA (rnfA) Recombinant Protein | rnfA1 recombinant protein
Recombinant Azoarcus sp. Electron transport complex protein RnfA (rnfA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Electron transport complex protein RnfA (rnfA); Recombinant Azoarcus sp. Electron transport complex protein RnfA (rnfA); Recombinant Electron transport complex protein RnfA (rnfA); Electron transport complex protein RnfA; Nitrogen fixation protein RnfA; rnfA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-193
Sequence
MSEWLMLLLGTALVNNVVLVKFLGLCPFMGVSKKVDSAIGMGMATTFVLTLASALTWLIEHFLLVPFDFGYLRILSFILVIAATVQFVEMVIKKTAPDLYKVLGIYLPLITTNCAVLGVALLNAGEGAGFVRSVLYGFGSALGFTMVMVLFAGLRERLALTSVPAAFSGAPISFITAGLLSLAFMGFAGLTNH
Sequence Length
193
Species
Azoarcus sp. (strain BH72)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,536 Da
NCBI Official Full Name
electron transport complex protein RnfA
NCBI Official Symbol
rnfA1
NCBI Protein Information
electron transport complex protein RnfA
UniProt Protein Name
Electron transport complex protein RnfA
UniProt Gene Name
rnfA
UniProt Entry Name
RNFA_AZOSB
Uniprot Description
Function: Required for nitrogen fixation. May be part of a membrane complex functioning as an intermediate in the electron transport to nitrogenase
By similarity. HAMAP-Rule MF_00459
Subunit structure: Composed of at least six subunits; RnfA, RnfB, RnfC, RnfD, RnfE and RnfG
By similarity.
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_00459.
Sequence similarities: Belongs to the NqrDE/RnfAE family.
Similar Products
Product Notes
The rnfA1 rnfa (Catalog #AAA1135709) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-193. The amino acid sequence is listed below: MSEWLMLLLG TALVNNVVLV KFLGLCPFMG VSKKVDSAIG MGMATTFVLT LASALTWLIE HFLLVPFDFG YLRILSFILV IAATVQFVEM VIKKTAPDLY KVLGIYLPLI TTNCAVLGVA LLNAGEGAGF VRSVLYGFGS ALGFTMVMVL FAGLRERLAL TSVPAAFSGA PISFITAGLL SLAFMGFAGL TNH. It is sometimes possible for the material contained within the vial of "Electron transport complex protein RnfA (rnfA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
