Probable E3 ubiquitin-protein ligase RNF217 (Rnf217) Recombinant Protein | Rnf217 recombinant protein
Recombinant Mouse Probable E3 ubiquitin-protein ligase RNF217 (Rnf217)
Gene Names
Rnf217; Ibrdc1; AU016819
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable E3 ubiquitin-protein ligase RNF217 (Rnf217); Recombinant Mouse Probable E3 ubiquitin-protein ligase RNF217 (Rnf217); Rnf217 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-515aa; full length protein
Sequence
MGEEQSTVSGSGGARASGGGSAGQPESPRPRGDRVRTAGPRAAASSSRPNGGGGGRDPGC VDASVQEPASNRAPAGQPARLPLSGPLDPQSLELQLEREAEGAGPREAPPGQQPPDGLLL DVLAQRHPPPAKPQVLCSVYCVESDLPEAPSAESPSPSESPPQAPLGPIPASPPPSFPSS PLSLPADPLSPDGGSIELEFYLAPEPFSVPGLLGAPPYSGLGGVGDPYAPLMVLMCRVCL EDKPIKPLPCCKKAVCEECLKIYLSSQVQLGQVEIKCPVTECFEFLEETTVVYNLTHEDS IKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESRYKIQCPTCQLIWCFKCH SPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTN FCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLVRGSVCAGKLFIAPLILVL GLALGAIAVVIGLFVFPIYCLCKKQRKRSRTGMHW
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Rnf217 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,036 Da
NCBI Official Full Name
probable E3 ubiquitin-protein ligase RNF217
NCBI Official Synonym Full Names
ring finger protein 217
NCBI Official Symbol
Rnf217
NCBI Official Synonym Symbols
Ibrdc1; AU016819
NCBI Protein Information
probable E3 ubiquitin-protein ligase RNF217
UniProt Protein Name
Probable E3 ubiquitin-protein ligase RNF217
Protein Family
UniProt Gene Name
Rnf217
UniProt Synonym Gene Names
Ibrdc1
UniProt Entry Name
RN217_MOUSE
Uniprot Description
RNF217: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Belongs to the RBR family. RNF217 subfamily.
Protein type: Ubiquitin ligase; EC 6.3.2.-; Ubiquitin conjugating system; Membrane protein, integral; EC 6.3.2.19; Ligase
Cellular Component: cytoplasm; integral to membrane; membrane; ubiquitin ligase complex
Molecular Function: coenzyme F420-0 gamma-glutamyl ligase activity; coenzyme F420-2 alpha-glutamyl ligase activity; ligase activity; metal ion binding; ribosomal S6-glutamic acid ligase activity; ubiquitin conjugating enzyme binding; ubiquitin-protein ligase activity; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; zinc ion binding
Biological Process: positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; protein ubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process
Similar Products
Product Notes
The Rnf217 rnf217 (Catalog #AAA7028782) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-515aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Rnf217 rnf217 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGEEQSTVSG SGGARASGGG SAGQPESPRP RGDRVRTAGP RAAASSSRPN GGGGGRDPGC VDASVQEPAS NRAPAGQPAR LPLSGPLDPQ SLELQLEREA EGAGPREAPP GQQPPDGLLL DVLAQRHPPP AKPQVLCSVY CVESDLPEAP SAESPSPSES PPQAPLGPIP ASPPPSFPSS PLSLPADPLS PDGGSIELEF YLAPEPFSVP GLLGAPPYSG LGGVGDPYAP LMVLMCRVCL EDKPIKPLPC CKKAVCEECL KIYLSSQVQL GQVEIKCPVT ECFEFLEETT VVYNLTHEDS IKYKYFLELG RIDSSTKPCP QCKHFTTFKK KGHIPTPSRS ESRYKIQCPT CQLIWCFKCH SPWHEGVNCK EYKKGDKLLR HWASEIEHGQ RNAQKCPKCK IHIQRTEGCD HMTCSQCNTN FCYRCGERYR QLRFFGDHTS NLSIFGCKYR YLPERPHLRR LVRGSVCAGK LFIAPLILVL GLALGAIAVV IGLFVFPIYC LCKKQRKRSR TGMHW. It is sometimes possible for the material contained within the vial of "Probable E3 ubiquitin-protein ligase RNF217 (Rnf217), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
