Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RNF217 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Rabbit anti-Human, Yeast RNF217 Polyclonal Antibody | anti-RNF217 antibody

RNF217 antibody - middle region

Gene Names
RNF217; OSTL; IBRDC1; C6orf172; dJ84N20.1
Reactivity
Human, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNF217; Polyclonal Antibody; RNF217 antibody - middle region; anti-RNF217 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV
Sequence Length
275
Applicable Applications for anti-RNF217 antibody
Western Blot (WB)
Homology
Human: 100%; Yeast: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RNF217
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RNF217 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-RNF217 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Related Product Information for anti-RNF217 antibody
This is a rabbit polyclonal antibody against RNF217. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RNF217 is an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Product Categories/Family for anti-RNF217 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
probable E3 ubiquitin-protein ligase RNF217 isoform b
NCBI Official Synonym Full Names
ring finger protein 217
NCBI Official Symbol
RNF217
NCBI Official Synonym Symbols
OSTL; IBRDC1; C6orf172; dJ84N20.1
NCBI Protein Information
probable E3 ubiquitin-protein ligase RNF217
UniProt Protein Name
Probable E3 ubiquitin-protein ligase RNF217
UniProt Gene Name
RNF217
UniProt Synonym Gene Names
C6orf172; IBRDC1

NCBI Description

This protein encoded by this gene is a member of the RING1-IBR-RING24 (RBR) ubiquitin protein ligase family, and it belongs to a subfamily of these proteins that contain a transmembrane domain. This protein can interact with the HAX1 anti-apoptotic protein via its C-terminal RING finger motif, which suggests a role in apoptosis signaling. It is thought that deregulation of this gene can be a mechanism in leukemogenesis. Mutations in the region encoding the protein GXXXG motif, which appears to be necessary for protein self-association, have been found in human cancers. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2016]

Uniprot Description

RNF217: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Belongs to the RBR family. RNF217 subfamily.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Ligase; Membrane protein, integral; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 6q22.31

Cellular Component: cytoplasm; cytosol; integral component of membrane; ubiquitin ligase complex

Molecular Function: metal ion binding; ubiquitin conjugating enzyme binding; ubiquitin-protein transferase activity

Biological Process: positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; protein ubiquitination involved in ubiquitin-dependent protein catabolic process

Research Articles on RNF217

Similar Products

Product Notes

The RNF217 rnf217 (Catalog #AAA3206865) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF217 antibody - middle region reacts with Human, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's RNF217 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF217 rnf217 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLALGAIAVV IVEEIKTYWN LISGRTRNQT QHLAPQPVLL SDMLYCLKQV. It is sometimes possible for the material contained within the vial of "RNF217, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.