E3 ubiquitin-protein ligase RNF181 (RNF181) Recombinant Protein | RNF181 recombinant protein
Recombinant Human E3 ubiquitin-protein ligase RNF181 (RNF181)
Gene Names
RNF181; HSPC238
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF181 (RNF181); Recombinant Human E3 ubiquitin-protein ligase RNF181 (RNF181); RNF181 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-153, Full length protein
Sequence
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Sequence Length
153
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,909 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF181
NCBI Official Synonym Full Names
ring finger protein 181
NCBI Official Symbol
RNF181
NCBI Official Synonym Symbols
HSPC238
NCBI Protein Information
E3 ubiquitin-protein ligase RNF181
UniProt Protein Name
E3 ubiquitin-protein ligase RNF181
Protein Family
UniProt Gene Name
RNF181
NCBI Description
RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM, Dec 2008]
Uniprot Description
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Research Articles on RNF181
Similar Products
Product Notes
The RNF181 rnf181 (Catalog #AAA1297490) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-153, Full length protein. The amino acid sequence is listed below: MASYFDEHDC EPSDPEQETR TNMLLELARS LFNRMDFEDL GLVVDWDHHL PPPAAKTVVE NLPRTVIRGS QAELKCPVCL LEFEEEETAI EMPCHHLFHS SCILPWLSKT NSCPLCRYEL PTDDDTYEEH RRDKARKQQQ QHRLENLHGA MYT. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF181 (RNF181), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
