Western Blot (WB)
(RNF181 rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human kidney.)
Rabbit anti-Human, Mouse RING Finger Protein 181 Polyclonal Antibody | anti-RNF181 antibody
RING Finger Protein 181 (RNF181, E3 Ubiquitin-protein Ligase RNF181, HSPC238) (FITC)
Gene Names
RNF181; HSPC238
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 181; Polyclonal Antibody; RING Finger Protein 181 (RNF181; E3 Ubiquitin-protein Ligase RNF181; HSPC238) (FITC); EC=6.3.2.-; anti-RNF181 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RNF181. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-RNF181 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RNF181, aa1-153 (NP_057578.1).
Immunogen Sequence
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(RNF181 rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human kidney.)
Western Blot (WB)
(RNF181 rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human kidney.)
Western Blot (WB)
(RNF181 rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human spleen.)
Western Blot (WB)
(RNF181 rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human spleen.)
Western Blot (WB)
(RNF181 rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in mouse kidney.)
Western Blot (WB)
(RNF181 rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in mouse kidney.)
Product Categories/Family for anti-RNF181 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,909 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF181
NCBI Official Synonym Full Names
ring finger protein 181
NCBI Official Symbol
RNF181
NCBI Official Synonym Symbols
HSPC238
NCBI Protein Information
E3 ubiquitin-protein ligase RNF181
UniProt Protein Name
E3 ubiquitin-protein ligase RNF181
Protein Family
UniProt Gene Name
RNF181
UniProt Entry Name
RN181_HUMAN
NCBI Description
RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM, Dec 2008]
Uniprot Description
RNF181: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Belongs to the RNF181 family.
Protein type: Ligase; Ubiquitin ligase; EC 6.3.2.-; Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 2p11.2
Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity
Biological Process: protein autoubiquitination
Research Articles on RNF181
Similar Products
Product Notes
The RNF181 rnf181 (Catalog #AAA6392741) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 181 (RNF181, E3 Ubiquitin-protein Ligase RNF181, HSPC238) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 181 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF181 rnf181 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 181, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
