Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rho-related GTP-binding protein RhoU (Rhou) Recombinant Protein | Rhou recombinant protein

Recombinant Mouse Rho-related GTP-binding protein RhoU (Rhou)

Gene Names
Rhou; Arhu; G28K; WRCH1; mG28K; WRCH-1; CDC42L1; AI182090; 2310026M05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rho-related GTP-binding protein RhoU (Rhou); Recombinant Mouse Rho-related GTP-binding protein RhoU (Rhou); Rhou recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-261, full length protein
Sequence
MAPQQGRPALPARCEPPAAPPVPPRRERGGRGARGPGVSGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPTSFQNVGEKWVPEIRRHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEVKAVSYIECSALTQKNLKEVFDAAIVAGIQHSDSQLQPKKSKSRTPDKVRDLSKSWWRKYCCLA
Sequence Length
261
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rhou recombinant protein
This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,354 Da
NCBI Official Full Name
rho-related GTP-binding protein RhoU
NCBI Official Synonym Full Names
ras homolog family member U
NCBI Official Symbol
Rhou
NCBI Official Synonym Symbols
Arhu; G28K; WRCH1; mG28K; WRCH-1; CDC42L1; AI182090; 2310026M05Rik
NCBI Protein Information
rho-related GTP-binding protein RhoU
UniProt Protein Name
Rho-related GTP-binding protein RhoU
UniProt Gene Name
Rhou
UniProt Synonym Gene Names
WRCH-1

Uniprot Description

Acts upstream of PAK1 to regulate the actin cytoskeleton, adhesion turnover and increase cell migration. Stimulates quiescent cells to reenter the cell cycle. Has no detectable GTPase activity but its high intrinsic guanine nucleotide exchange activity suggests it is constitutively GTP-bound. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape ().

Research Articles on Rhou

Similar Products

Product Notes

The Rhou rhou (Catalog #AAA1433502) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-261, full length protein. The amino acid sequence is listed below: MAPQQGRPAL PARCEPPAAP PVPPRRERGG RGARGPGVSG GRGRAGGAEG RGVKCVLVGD GAVGKTSLVV SYTTNGYPTE YIPTAFDNFS AVVSVDGRPV RLQLCDTAGQ DEFDKLRPLC YTNTDIFLLC FSVVSPTSFQ NVGEKWVPEI RRHCPKAPII LVGTQSDLRE DVKVLIELDK CKEKPVPEEA AKLCAEEVKA VSYIECSALT QKNLKEVFDA AIVAGIQHSD SQLQPKKSKS RTPDKVRDLS KSWWRKYCCL A. It is sometimes possible for the material contained within the vial of "Rho-related GTP-binding protein RhoU (Rhou), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.