Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CDKN1A Monoclonal Antibody | anti-CDKN1A antibody

CDKN1A (Cyclin-dependent Kinase Inhibitor 1, CDK-interacting Protein 1, Melanoma Differentiation-associated Protein 6, MDA-6, p21, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1) (AP)

Gene Names
CDKN1A; P21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDKN1A; Monoclonal Antibody; CDKN1A (Cyclin-dependent Kinase Inhibitor 1; CDK-interacting Protein 1; Melanoma Differentiation-associated Protein 6; MDA-6; p21; CAP20; CDKN1; CIP1; MDA6; PIC1; SDI1; WAF1) (AP); anti-CDKN1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F1
Specificity
Recognizes human CDKN1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
164
Applicable Applications for anti-CDKN1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa65-164 from human CDKN1A (AAH00312.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CDKN1A monoclonal antibody. Western Blot analysis of CDKN1A expression in human liver.)

Western Blot (WB) (CDKN1A monoclonal antibody. Western Blot analysis of CDKN1A expression in human liver.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDKN1A on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CDKN1A on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CDKN1A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDKN1A is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and CDKN1A. HeLa cells were stained with CASP3 rabbit purified polyclonal 1:1200 and CDKN1A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and CDKN1A. HeLa cells were stained with CASP3 rabbit purified polyclonal 1:1200 and CDKN1A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-CDKN1A antibody
References
1. Phospho-?GNp63? is a key regulator of the cisplatin-induced microRNAome in cancer cells. Huang Y, Chuang A, Hao H, Talbot C, Sen T, Trink B, Sidransky D, Ratovitski E.Cell Death Differ. 2011 Jan 28.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Cyclin-dependent kinase inhibitor 1A (p21, Cip1)
NCBI Official Synonym Full Names
cyclin dependent kinase inhibitor 1A
NCBI Official Symbol
CDKN1A
NCBI Official Synonym Symbols
P21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1
NCBI Protein Information
cyclin-dependent kinase inhibitor 1

NCBI Description

This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen, a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of cyclin-dependent kinase2, and may be instrumental in the execution of apoptosis following caspase activation. Mice that lack this gene have the ability to regenerate damaged or missing tissue. Multiple alternatively spliced variants have been found for this gene. [provided by RefSeq, Sep 2015]

Research Articles on CDKN1A

Similar Products

Product Notes

The CDKN1A (Catalog #AAA6130523) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDKN1A (Cyclin-dependent Kinase Inhibitor 1, CDK-interacting Protein 1, Melanoma Differentiation-associated Protein 6, MDA-6, p21, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKN1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDKN1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDKN1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.