Transforming protein RhoA Recombinant Protein | RHOA recombinant protein

Recombinant Human Transforming protein RhoA

Cat. Num. AAA717152

• Gene Names: RHOA; ARHA; ARH12; RHO12; RHOH12
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transforming protein RhoA; Recombinant Human Transforming protein RhoA; Rho cDNA clone 12; h12; RHOA recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-191aa; Partial
• Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCL
• Sequence Length: 191

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for RHOA recombinant protein

Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. Stimulates PKN2 kinase activity. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis

Product Categories/Family for RHOA recombinant protein

Cell Cycle

References

Nucleotide sequence of human rho cDNA clone 12.Yeramian P., Chardin P., Madaule P., Tavitian A.Nucleic Acids Res. 15:1869-1869(1987)

NCBI and Uniprot Product Information

• NCBI GI #: 927669104
• NCBI GeneID: 387
• NCBI Accession #: NP_001300870.1
• NCBI GenBank Nucleotide #: NM_001313941.1
• UniProt Accession #: P61586; P06749; Q53HM4; Q5U024; Q9UDJ0; Q9UEJ4
• Molecular Weight: 48.6 kDa
• NCBI Official Full Name: transforming protein RhoA isoform 1
• NCBI Official Synonym Full Names: ras homolog family member A
• NCBI Official Symbol: RHOA
• NCBI Official Synonym Symbols: ARHA; ARH12; RHO12; RHOH12
• NCBI Protein Information: transforming protein RhoA
• UniProt Protein Name: Transforming protein RhoA
• Protein Family: Transforming protein
• UniProt Gene Name: RHOA
• UniProt Synonym Gene Names: ARH12; ARHA; RHO12; h12
• UniProt Entry Name: RHOA_HUMAN

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]

Uniprot Description

RHOA: a small G protein of the Rho family. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Controls the reorganization of actins into podosomes. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders.

Protein type: Motility/polarity/chemotaxis; G protein, monomeric; G protein, monomeric, Rho; G protein; Oncoprotein

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: apical junction complex; cell cortex; cell junction; cleavage furrow; cytoskeleton; cytosol; endoplasmic reticulum membrane; endosome; focal adhesion; lamellipodium; midbody; plasma membrane; vesicle

Molecular Function: GTP binding; GTPase activity; myosin binding; protein binding

Biological Process: actin cytoskeleton organization and biogenesis; apical junction assembly; axon guidance; blood coagulation; endothelial cell migration; ephrin receptor signaling pathway; negative chemotaxis; negative regulation of axonogenesis; nerve growth factor receptor signaling pathway; phosphoinositide-mediated signaling; platelet activation; positive regulation of axonogenesis; positive regulation of cytokinesis; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of lipase activity; positive regulation of neuron differentiation; positive regulation of NF-kappaB import into nucleus; positive regulation of stress fiber formation; regulation of actin cytoskeleton organization and biogenesis; regulation of axonogenesis; regulation of cell migration; regulation of osteoblast proliferation; regulation of small GTPase mediated signal transduction; Rho protein signal transduction; small GTPase mediated signal transduction; substantia nigra development; transforming growth factor beta receptor signaling pathway; vascular endothelial growth factor receptor signaling pathway; viral reproduction